KEGG   Pan paniscus (bonobo): 100995920Help
Entry
100995920         CDS       T02283                                 

Gene name
PPP2R1A
Definition
(RefSeq) protein phosphatase 2 scaffold subunit Aalpha
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03015  mRNA surveillance pathway
pps04071  Sphingolipid signaling pathway
pps04114  Oocyte meiosis
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04261  Adrenergic signaling in cardiomyocytes
pps04350  TGF-beta signaling pathway
pps04390  Hippo signaling pathway
pps04530  Tight junction
pps04728  Dopaminergic synapse
pps04730  Long-term depression
pps05142  Chagas disease (American trypanosomiasis)
pps05160  Hepatitis C
pps05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100995920 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100995920 (PPP2R1A)
   04390 Hippo signaling pathway
    100995920 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    100995920 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    100995920 (PPP2R1A)
   04152 AMPK signaling pathway
    100995920 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100995920 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100995920 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100995920 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    100995920 (PPP2R1A)
   04730 Long-term depression
    100995920 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100995920 (PPP2R1A)
   05165 Human papillomavirus infection
    100995920 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100995920 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100995920 (PPP2R1A)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100995920 (PPP2R1A)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100995920 (PPP2R1A)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100995920 (PPP2R1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Motif
Other DBs
NCBI-GeneID: 100995920
NCBI-ProteinID: XP_003807682
UniProt: A0A2R8ZN14
Position
19
AA seq 589 aa AA seqDB search
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgacggcgacgactcgctgtaccccatcgcggtgctcatagacgaactc
cgcaatgaggacgttcagcttcgcctcaacagcatcaagaagctgtccaccatcgccttg
gcccttggggttgaaaggacccgaagtgagcttctgcctttccttacagataccatctat
gatgaagatgaagtcctcctggccctggcagaacagctgggaaccttcactaccctggtg
ggaggcccagagtacgtgcactgcctgctgccaccgctggagtcgctggccacagtggag
gagacagtggtgcgggacaaggcagtggagtccttacgggccatctcacacgagcactcg
ccctctgacctggaggcgcactttgtgccgctagtgaagcggctggcgggcggcgactgg
ttcacctcccggacctcggcctgcggcctcttctccgtctgctacccccgagtgtccagt
gctgtgaaggcggaacttcgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgcagcctccaagctgggggagtttgccaaggtgctggagctggacaac
gtcaagagtgagatcatccccatgttctccaacctggcctctgacgagcaggactcggtg
cggctgctggcggtggaggcgtgcgtgaacatcgcccagcttctgccccaggaggatctg
gaggccctggtgatgcccactctgcgccaggctgctgaagacaagtcctggcgcgtccgc
tacatggtggctgacaagttcacagagctccagaaagcagtggggcctgagatcaccaag
acagacctggtccctgccttccagaacctgatgaaagactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagagttctgtgaaaacctctcagctgactgtcgggagaat
gtgatcatgtcccagatcttgccctgcatcaaggagctggtgtccgatgccaaccaacat
gtcaagtctgccctggcctcagtcatcatgggtctctctcccatcttgggcaaagacaac
accatcgagcacctcttgcccctcttcctggctcagctgaaggatgagtgccctgaggta
cggctgaacatcatctctaacctggactgtgtgaacgaggtgattggcatccggcagctg
tcccagtccctgctccctgccattgtggagctggctgaggacgccaagtggcgggtgcgg
ctggccatcattgagtacatgcccctcctggctggacagctgggagtggagttctttgat
gagaaacttaactccttgtgcatggcctggcttgtggatcatgtatatgccatccgcgag
gcagccaccagcaacctgaagaagctagtggaaaagtttgggaaggagtgggcccatgcc
acaatcatccccaaggtcttggccatgtccggagaccccaactacctgcaccgcatgact
acgctcttctgcatcaatgtgctgtctgaggtctgtgggcaggacatcaccaccaagcac
atgctacccacggttctgcgcatggctggggacccggttgccaatgtccgcttcaatgtg
gccaagtctctgcagaagatagggcccatcctggacaacagcaccttgcagagtgaagtc
aagcccatcctagagaagctgacccaggaccaggatgtggacgtcaaatactttgcccag
gaggctctgactgttctgtctctcgcctga

DBGET integrated database retrieval system