KEGG   Pan paniscus (bonobo): 100996152
Entry
100996152         CDS       T02283                                 

Gene name
ALKBH1
Definition
(RefSeq) alkB homolog 1, histone H2A dioxygenase
  KO
K10765  alkylated DNA repair protein alkB homolog 1 [EC:1.14.11.51 4.2.99.18 1.14.11.-]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100996152 (ALKBH1)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.51  DNA N6-methyladenine demethylase
     100996152 (ALKBH1)
    1.14.11.-  
     100996152 (ALKBH1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     100996152 (ALKBH1)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_2
Other DBs
NCBI-GeneID: 100996152
NCBI-ProteinID: XP_003808929
UniProt: A0A2R9C7C9
Position
14
AA seq 389 aa
MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQ
KVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLK
LYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWD
SKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHS
KPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEG
LPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIKD
EKRDISTEGFCHLDDQNSEVKRARINPDS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggggaagatggcagcggccgtgggctctgtggcgactctggcgactgagcccggggag
gacgcctttcggaaacttttccgcttctaccgtcagagccggcccgggaccgcagacctg
gaaggggtcatcgacttctcggcggcccacgcagcccgtggcaagggtcctggtgcccaa
aaggtgatcaaatctcagctaaatgtgtcttctgtcagtgagcagaatgcatatagagca
ggtcttcagcccgtcagcaagtggcaagcctatggactcaaaggctatcctgggtttatt
tttatcccaaaccccttcctcccaggttaccagtggcactgggtgaaacagtgccttaag
ttatattcccagaaacctaatgtatgtaacctggacaaacacatgtctaaagaagagacc
caagatctgtgggaacagagcaaagagttcctcaggtataaagaagcaactaaacggaga
ccccgaagtttactggagaaactgcgttgggtgaccgtaggctaccattataactgggac
agtaagaaatactcagcagatcattacacacctttcccttctgacctgggtttcctctca
gaacaagtagccgctgcctgtggatttgaggatttccgagccgaagcagggatcctgaat
tactaccgcctggactccacactgggaatccacgtagacagatctgagctagatcactcc
aaacccttgctgtcattcagctttggacagtccgccatctttctcctgggtggtcttcaa
agggatgaggcccccacggccatgtttatgcacagtggtgacatcatgataatgtcgggt
ttcagccgcctcttgaaccacgcagtccctcgtgtccttccaaatccagaaggggaaggc
ctgcctcactgcctagaggcacctctccctgctgtcctcccgagagattcaatggtagag
ccttgttctatggaggactggcaggtgtgtgccagctacttgaagaccgctcgtgttaac
atgactgtccgacaggtcctggccacagaccagaatttccctctagaacccatcaaggat
gaaaaaagagacatcagtacagaaggtttctgccatctggatgaccagaatagcgaagta
aaacgggccaggataaaccctgacagctga

DBGET integrated database retrieval system