KEGG   Pan paniscus (bonobo): 103783188Help
Entry
103783188         CDS       T02283                                 

Definition
(RefSeq) aldo-keto reductase family 1 member C2-like
  KO
K00089  3alpha-hydroxysteroid 3-dehydrogenase [EC:1.1.1.213 1.1.1.357]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    103783188
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     103783188
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     103783188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 103783188
NCBI-ProteinID: XP_008951350
Position
10
AA seq 146 aa AA seqDB search
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKAQEAVKLAIEAGFRHIDSAHVYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKVGTLCDQINFTFVLSINIVFMEI
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaaataccagtgtgtgaagctgaatgatggtcacttcatgcctgtcctggga
tttggcacctatgcgcctgcagaggttcctaaaagtaaagctcaagaggccgtcaaattg
gcaatagaagccgggttccgccatattgattctgcacatgtttacaataatgaggagcag
gttggactggccatccgaagcaagattgcagatggcagtgtgaagagagaagacatattc
tacacttcaaagctttggagcaattcccatcgaccagagttggtccgaccagccttggaa
aggtcactgaaaaatcttcaattggactatgttgacctctaccttattcattttccagtg
tctgtaaaggtaggcaccttgtgtgatcaaattaatttcacttttgttctcagcataaat
attgttttcatggagatttga

DBGET integrated database retrieval system