KEGG   Pan paniscus (bonobo): 103786410
Entry
103786410         CDS       T02283                                 

Gene name
MYC
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04012  ErbB signaling pathway
pps04110  Cell cycle
pps04151  PI3K-Akt signaling pathway
pps04218  Cellular senescence
pps04310  Wnt signaling pathway
pps04350  TGF-beta signaling pathway
pps04390  Hippo signaling pathway
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04630  JAK-STAT signaling pathway
pps04919  Thyroid hormone signaling pathway
pps05132  Salmonella infection
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05213  Endometrial cancer
pps05216  Thyroid cancer
pps05219  Bladder cancer
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05222  Small cell lung cancer
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103786410 (MYC)
   04012 ErbB signaling pathway
    103786410 (MYC)
   04310 Wnt signaling pathway
    103786410 (MYC)
   04350 TGF-beta signaling pathway
    103786410 (MYC)
   04390 Hippo signaling pathway
    103786410 (MYC)
   04630 JAK-STAT signaling pathway
    103786410 (MYC)
   04151 PI3K-Akt signaling pathway
    103786410 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103786410 (MYC)
   04218 Cellular senescence
    103786410 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103786410 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103786410 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103786410 (MYC)
   05202 Transcriptional misregulation in cancer
    103786410 (MYC)
   05206 MicroRNAs in cancer
    103786410 (MYC)
   05205 Proteoglycans in cancer
    103786410 (MYC)
   05230 Central carbon metabolism in cancer
    103786410 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103786410 (MYC)
   05225 Hepatocellular carcinoma
    103786410 (MYC)
   05226 Gastric cancer
    103786410 (MYC)
   05216 Thyroid cancer
    103786410 (MYC)
   05221 Acute myeloid leukemia
    103786410 (MYC)
   05220 Chronic myeloid leukemia
    103786410 (MYC)
   05219 Bladder cancer
    103786410 (MYC)
   05213 Endometrial cancer
    103786410 (MYC)
   05224 Breast cancer
    103786410 (MYC)
   05222 Small cell lung cancer
    103786410 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103786410 (MYC)
   05161 Hepatitis B
    103786410 (MYC)
   05160 Hepatitis C
    103786410 (MYC)
   05163 Human cytomegalovirus infection
    103786410 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103786410 (MYC)
   05169 Epstein-Barr virus infection
    103786410 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103786410 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    103786410 (MYC)
   03019 Messenger RNA biogenesis [BR:pps03019]
    103786410 (MYC)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    103786410 (MYC)
Messenger RNA biogenesis [BR:pps03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     103786410 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Other DBs
NCBI-GeneID: 103786410
NCBI-ProteinID: XP_003820503
UniProt: A1YG22
Position
8
AA seq 439 aa
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDGSSPKSCPSQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgttagcttcaccaacaggaactatgacctcgactacgactcggtgcag
ccgtatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagcccccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccctcctacgttgcggtcacgcccttc
tcccttcggggagacaacgacggcggtggcgggagcttctccacggccgaccagctggag
atggtgaccgagctgctgggaggagacatggtgaaccagagtttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcagagaagctggcctcctaccaggctgcgcgcaaagacagcggc
agcccgaaccccgcccgcggccacagcgtctgctccacctccagcttgtacctgcaggat
ctgagcgccgccgcctcagagtgcatcgacccctcggtggtcttcccctaccctctcaac
gacggcagctcgcccaagtcctgcccctcgcaagactccagcgccttctctccgtcctcg
gattctctgctctcctcgacggagtcctccccgcagggcagccccgagcccctggtgctc
catgaggagacaccgcccaccaccagcagcgactctgaggaggaacaagaagatgaggaa
gaaatcgatgttgtttctgtggaaaagaggcaggctcctggcaaaaggtcagagtctgga
tcaccttctgctggaggccacagcaaacctcctcacagcccactggtcctcaagaggtgc
cacgtctccacacatcagcacaactacgcagcgcctccctccactcggaaggactatcct
gctgccaagagggtcaagttggacagtgtcagagtcctgagacagatcagcaacaaccga
aaatgcaccagccccaggtcctcggacaccgaggagaatgacaagaggcgaacacacaac
gtcttggagcgccagaggaggaacgagctaaaacggagcttttttgccctgcgtgaccag
atcccggagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccaca
gcatacatcctgtccgtccaagcagaggagcaaaagctcatttctgaggaggacttgttg
cggaaacgacgagaacagttgaaacacaaacttgaacagctacggaactcttgtgcgtaa

DBGET integrated database retrieval system