KEGG   Pseudomonas pseudoalcaligenes: BN5_0066Help
Entry
BN5_0066          CDS       T03772                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppse  Pseudomonas pseudoalcaligenes
Pathway
ppse00010  Glycolysis / Gluconeogenesis
ppse00071  Fatty acid degradation
ppse00350  Tyrosine metabolism
ppse00625  Chloroalkane and chloroalkene degradation
ppse00626  Naphthalene degradation
ppse01100  Metabolic pathways
ppse01110  Biosynthesis of secondary metabolites
ppse01120  Microbial metabolism in diverse environments
ppse01130  Biosynthesis of antibiotics
ppse01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN5_0066 (adhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN5_0066 (adhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BN5_0066 (adhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BN5_0066 (adhA)
   00626 Naphthalene degradation
    BN5_0066 (adhA)
Enzymes [BR:ppse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BN5_0066 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CDM38682
UniProt: W6QQA5
Position
67205..68227
Genome map
AA seq 340 aa AA seqDB search
MNQTMKAAVVHAFGQPLRIEEVNTPLPGPGQILVKIEASGVCHTDLHAAEGDWPVKPSLP
FIPGHEGVGYVAAVGSGVTRVKEGDRVGVPWLYTACGCCEHCLTGWETLCESQQNTGYSI
NGGYAEYVLADPNYVGILPKSVDFLEIAPILCAGVTVYKGLKETGARPGQWVAISGIGGL
GHVAVQYARAMGLHVIAVDVDDAKLELARKLGASLTINARKENPAEVVQRDIGGAHGVLV
TAVSNAAFGQAIGMARRRGTVALVGLPPGDFPTPIFDVVLKAITITGSIVGTRADLQEAL
DFAGEGLVKATVHSDTLDNINGIFEQMRGGQIEGRVVLQF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaccatgaaagccgccgtcgtccacgccttcgggcagccgttgcgtatcgag
gaggtgaacaccccactgcccggccccgggcagattctggtgaaaatcgaggcctcgggc
gtctgtcacaccgacctgcacgccgccgagggtgactggccggtgaaaccgagtctgccg
ttcattcccggccacgagggcgttggctacgtggcggcggtcggcagcggcgtcacgcgg
gtcaaggaaggcgaccgtgtcggcgtgccctggctgtacaccgcctgcggctgctgcgag
cactgcctgaccggctgggaaaccctgtgcgagagccagcagaacaccggctattcgatc
aacggcggttacgccgaatacgtgctggctgatccgaactacgtcggcatcctgccgaaa
agcgtcgattttctggaaattgcgccgatcctttgcgccggcgtgacggtgtacaagggg
ctcaaggaaaccggggcgcgccccggccagtgggtggcgatctccggtatcggcggcctc
ggccacgttgcagtgcagtatgcccgcgccatgggcctgcacgtcatcgcggtggatgtc
gacgacgccaagctggagctggcgcgcaagctcggcgccagcctgaccatcaatgcgcgg
aaggaaaatccggccgaggtggtgcagcgcgatatcggtggcgcccatggcgtactggtc
acagcggtgtccaacgccgcctttggccaggccatcggtatggcacgccggcgcggcacc
gtggcgctggtcggcctgccgccaggtgacttccccacgccgattttcgacgtggtgctc
aaggccatcacgatcaccggctcgatcgtcggcacccgcgccgatttgcaggaggcactg
gatttcgctggcgagggcctggtcaaggccacggtgcacagcgacacgctcgacaacatc
aatggcatcttcgagcagatgcgcggcgggcagatcgaggggcgggtggtgctgcagttc
tga

DBGET integrated database retrieval system