KEGG   Pseudomonas pseudoalcaligenes: BN5_0876Help
Entry
BN5_0876          CDS       T03772                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppse  Pseudomonas pseudoalcaligenes
Pathway
ppse00071  Fatty acid degradation
ppse00072  Synthesis and degradation of ketone bodies
ppse00280  Valine, leucine and isoleucine degradation
ppse00310  Lysine degradation
ppse00362  Benzoate degradation
ppse00380  Tryptophan metabolism
ppse00620  Pyruvate metabolism
ppse00630  Glyoxylate and dicarboxylate metabolism
ppse00640  Propanoate metabolism
ppse00650  Butanoate metabolism
ppse00900  Terpenoid backbone biosynthesis
ppse01100  Metabolic pathways
ppse01110  Biosynthesis of secondary metabolites
ppse01120  Microbial metabolism in diverse environments
ppse01130  Biosynthesis of antibiotics
ppse01200  Carbon metabolism
ppse01212  Fatty acid metabolism
ppse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN5_0876
   00630 Glyoxylate and dicarboxylate metabolism
    BN5_0876
   00640 Propanoate metabolism
    BN5_0876
   00650 Butanoate metabolism
    BN5_0876
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN5_0876
   00072 Synthesis and degradation of ketone bodies
    BN5_0876
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN5_0876
   00310 Lysine degradation
    BN5_0876
   00380 Tryptophan metabolism
    BN5_0876
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN5_0876
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN5_0876
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN5_0876
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppse04147]
    BN5_0876
Enzymes [BR:ppse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN5_0876
Exosome [BR:ppse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN5_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDM39485
UniProt: W6QRD3
Position
complement(935518..936693)
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVSGARTPMGGFQGSLASVPAVDLGAAAIREAVKRAGIEPADVQEVIMGCVLPAG
LKQGPARQASLNAGLPSATGCTTINKLCGSGMKAVMMAFDSLKAGSNQVMIAGGMESMSN
APYVLEKARTGLRMGHGEIKDHMFLDGLEDARTGRLMGSFAQETADQYGITREEMDAYAI
ESLRRAQAAIKDGSLDAEIVPVTVTTRKGEVVVKDDEQPLTANLDKIPALKPAFKKDGTI
TAANASSISDGASALLLMTADEAAKRGLKPLAKVVAHATQSQAPSEFTLAPIGAMGNLLK
KTGWSKDEIDLFEINEAFAMVTMLAMREHGLDHAKVNIFGGACAQGHPVGSTGSRIILTL
INALQKKGGKRGIASLCIGGGEATAVAIELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatcgtcatcgtcagcggcgcccgcactcccatgggcggttttcaaggcagc
ctggccagcgtgccggccgtcgatctgggtgctgctgccattcgtgaagcagtcaagcgc
gccggtatcgagccagccgacgtgcaggaagtaatcatgggctgcgtgctgcccgccggc
ctcaagcaaggcccggcgcgccaggcgtcgctcaatgccggcctgccatctgccaccggc
tgcaccaccatcaacaagctgtgcggctcgggcatgaaggcggtgatgatggccttcgat
tcgctgaaggccggtagcaaccaggtcatgatcgccggcggcatggaaagcatgtccaac
gcgccctatgtgctggaaaaggcccgcaccggcctgcgcatgggccatggcgagatcaag
gaccacatgttcctcgacggcctggaagacgcgcgcactggccgcctgatgggctccttc
gcccaggaaacggccgaccagtacggcatcacccgtgaggaaatggacgcctatgccatc
gaatcgctgcgccgcgcgcaggcggcgatcaaggacggctcgctggacgcggagatcgtt
ccggtcaccgtcaccacgcgcaagggtgaagtggtggtcaaggatgatgaacagccgctg
acggccaacctggacaagattcctgcgctcaaacccgccttcaagaaagacggcaccatc
accgccgccaacgccagttctatttccgacggcgccagcgcactgctattgatgactgct
gatgaagccgccaagcgcggtctcaagccgctggccaaggtggttgcccacgcgacgcag
agccaggccccgagcgagttcaccctggcccccatcggcgccatgggcaacctgctgaaa
aaaaccggctggagcaaggatgagatcgatctgttcgagatcaacgaagccttcgccatg
gtgaccatgctggccatgcgcgaacacggcctggatcacgccaaggtcaacatcttcggc
ggtgcctgcgcccagggtcacccggtcggttctaccggctcgcggatcatcctcaccctg
atcaacgccctgcagaagaaaggcggcaaacgcggcatcgcctcgctgtgtatcggcggc
ggcgaagccacagcagtcgccatcgaactgctgtaa

DBGET integrated database retrieval system