KEGG   Pseudomonas pseudoalcaligenes: BN5_1660Help
Entry
BN5_1660          CDS       T03772                                 

Gene name
recB1
Definition
(GenBank) DNA helicase/exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
ppse  Pseudomonas pseudoalcaligenes
Pathway
ppse03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppse00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BN5_1660 (recB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppse03400]
    BN5_1660 (recB1)
Enzymes [BR:ppse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BN5_1660 (recB1)
DNA repair and recombination proteins [BR:ppse03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BN5_1660 (recB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 AAA_25 AAA_11
Motif
Other DBs
NCBI-ProteinID: CDM40251
UniProt: W6R1L2
Position
1750060..1753689
Genome map
AA seq 1209 aa AA seqDB search
MSQQRPLALTFPLHGSRLIEASAGTGKTFTISALYLRLVLGHGGDAAFREPLLPPQILVV
TFTDAATRELRDRIRARLVEAATVFRGDAQGDDLLRELRSDFAQTQWDECARRLELAAQW
MDEAAVSTIHGWCQRMLREHAFDSGSLFSQTLETDHSELLAEVVRDYWRQHCYPLQGAAL
QWVAGVWGTPAGLGSRVRPLLGEEGEVATQALGELLDAALQQREQALAELKAPWLTWADE
LQLLLDAAVAAKQVDGKKIQARFYNPWLAKLREWAGGEESRLDLGTGFTRLTPDGLAEAW
KGKAPDHPALDAMALLKAQLDALPDPADAALRHAAAWVRQRFDWEKRQRAEMGFDDMLVR
LDAALQGSNGPRLAEVIRRQFPVAMIDEFQDTDPLQYRIFDTLYEVEVNRDDCGLFMIGD
PKQAIYSFRGADIHTYLRARRATSGRHYNLEKNFRSSQAMVDAVNGVFLRAEQREGGEGA
FLLRDDLPFIEVGAQGRREVWSVDGQAQPAMTVWQLASDEPVAKGAYLDAMAAGAASEIV
RLLDLGQRGQAGFSKEGALSALRPSDIAVLVRDFNEAQAIRGELAARGVRSVYLSDKDSV
FAAQEARDLLLWLRACAEPDQDRPLRAALASATLGLALSELEQLNLDERTWERRVMQFRD
YRQRWQRQGVLPMLRQLLQDFELPQRLMGRDDGERVLTNLLHLAELLQQAAAELDGELAL
IRHLSELLAGEGQAADEQVLRLESDEALVRVVTIHKSKGLEYPLVFLPFICAFRPVDDKK
PLQIHDGERRRLVLKADEDSLERAERERLGEDLRLLYVALTRARHACWLGVADLKIGNGK
KSRLHESALGYLLGGGLPLAASGELASWLAPFASGLDSAVSPVPPASEQRYRMIEDEQFE
PHWRTPVRRAAEHWWIASYSALRLDEDAPSQVSRHEDAAPDSPAMQNAIDDENPLLALAP
LPASAQGLHRFPRGPNPGTFLHGLLEMAAQEGFAALAQEPSRLREALARRCQRRGLESWI
DPLLDWLLAFLTQPLPLTGTDAVVLAQLTQYQPELEFWFEARGVDVRLLDQWVQQCELPG
VARQPLRADILNGMFKGFIDLVFEHQGRYYVADYKSNWLGSDDIAYTREAMESAIASHRY
DLQYVLYVLALHRQLRLRLPDYDYDRHLGGALYLFLRAPQQGAYLARPPRALIEHLDVLF
MGEAEEGAA
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacagcgccctctggccctgacgtttcccctgcatggcagtcgcctgatcgaa
gccagcgccggcactggcaagaccttcaccatttccgcgctgtatctgcggctggtcctt
ggccatggcggcgacgccgcgttccgcgagcccctgctgccgccgcagattctggtggtg
accttcaccgatgcggctacgcgcgaattgcgcgaccggattcgcgcgcgcctggtcgaa
gccgcgaccgtatttcgtggcgatgcccaaggcgatgatctgctgcgcgaattgcgcagt
gacttcgcccagacgcagtgggacgaatgtgcccgccgccttgagctggcggcgcagtgg
atggacgaggctgcggtgtccaccatccacggctggtgtcagcgcatgctgcgcgagcat
gccttcgacagcggcagcctgttcagccagaccctggagaccgaccacagcgagctgttg
gccgaggtggtgcgcgactactggcggcagcactgctatccgttgcagggcgcggcgctg
caatgggtcgcgggtgtctgggggacgcctgcggggctgggtagcagggtgcggccgttg
ttgggcgaagagggggaggtcgcaacgcaagcgctgggcgaactgctcgatgctgcgctg
cagcagcgcgagcaggctcttgccgagctcaaggcaccgtggctgacctgggccgatgaa
ctgcagctgctgctggacgctgcagtggcggccaagcaggtggacggcaagaaaatccag
gcgcgcttttacaacccctggttggccaagttacgcgagtgggctggcggcgaagagtcg
cgtctcgacctgggcacaggcttcactcgcctgaccccagatggcctggccgaagcctgg
aagggcaaggcgcctgatcatcccgcgctggacgcgatggctttgctcaaggcgcaactc
gatgcgctgccggaccccgctgatgcggctttgcgccacgcggcggcttgggttcgccag
cgcttcgattgggagaaacgccagcgcgcggagatgggcttcgatgacatgcttgtgcgt
ttggacgctgccctgcaaggcagcaacggtccgcgcctggccgaggtgatccgccgccag
ttcccggtggcgatgatcgacgagttccaggacaccgacccgctgcagtaccgcatcttc
gatacgctctacgaagtcgaggttaatcgcgacgactgcggcctgttcatgatcggcgac
cccaagcaggccatctattccttccgtggcgccgatatccacacctacctgcgtgcgcgc
cgggcgacatccgggcgccactacaacctggaaaagaacttccgctccagtcaggccatg
gtcgatgccgtcaatggcgttttcctgcgcgccgaacagcgtgaaggcggcgagggagcg
ttcctgctgcgcgacgatctgccttttatcgaggtgggcgctcaaggtcgacgcgaagtc
tggagtgtcgacggccaggcgcaacccgctatgacggtgtggcaactggcgagcgacgag
ccggttgccaagggcgcctatctggatgccatggcggctggtgcagccagtgagatcgtg
cgtttgctggatctgggccagcgcgggcaggccggctttagcaaggagggcgcgctcagc
gctctgcggcccagcgacatcgcggtgctggtgcgcgacttcaacgaggcgcaggccatt
cgcggcgagctggctgcgcggggcgtgcgcagcgtctacctttccgacaaggattcggtg
ttcgccgcccaggaggcacgcgacttgctgctgtggctgcgtgcctgcgctgagccggat
caggatcgaccgctgcgtgcagcgctggccagcgcgacgctggggttggcgttgagcgag
ctggagcagctcaatctcgacgagcgcacctgggagcgccgcgtcatgcagttccgcgac
tatcgccagcgctggcagcgccagggtgtgctgccgatgctgcgccaactgttgcaagac
ttcgagctgccgcaacggctgatggggcgtgacgatggcgagcgagtactgaccaatctg
ttgcatcttgctgagctgctgcagcaggctgccgctgaacttgatggcgagctggcgctg
attcggcacttgagcgagctgctggctggcgaggggcaggctgccgatgagcaggtgttg
cgcctggagagtgacgaagcgctggtgcgcgtggtgaccatccacaaatccaagggcctg
gaataccccctggtgttcctgccgttcatctgcgccttccgcccggtggatgacaagaaa
ccgttgcaaatccacgacggcgagcgccgccgactggtgctcaaggccgatgaagacagc
ctggagcgcgccgagcgtgagcgtctgggtgaagacttgcgcctgctctatgtggcgctg
acccgtgcgcgtcatgcctgctggttgggtgtggcggatctgaagatcggcaacggcaag
aagtcgcgcctgcatgaatcggcgttgggctacttgctcgggggcggattgcctctggcg
gccagcggcgagcttgccagctggctcgcgccgttcgccagcggactcgatagcgccgtg
tcgcctgtgccgcccgccagcgagcagcgctatcgcatgatcgaagatgagcagttcgag
ccgcattggcgtacgccagtacgacgcgcagccgaacattggtggatcgcctcctacagt
gcgctgcgcctggacgaggatgcgcccagccaggtcagtcgccatgaagacgccgcgccc
gacagtccggcgatgcagaacgccatcgacgacgagaacccgttgctggctctggcgccg
ctacctgcatcggctcaggggctgcatcgcttcccgcgcgggcccaatcccggcaccttc
ctccatggtctgctggaaatggcggcgcaggaaggcttcgccgcgctggcgcaggaacct
tcgaggttgcgcgaggcactggccaggcgctgccagcgtcgcggcctggaaagctggatc
gacccgctgctggactggttgctggcgtttctgactcaaccgctgccgctgactggcacg
gatgccgtggtgctggcgcaactgacgcaatatcagcccgagctggagttctggttcgag
gcccgcggggtggacgtcaggctgctggatcagtgggtgcagcagtgcgagttgccaggc
gtcgccaggcagccgctgcgtgccgacatcctcaacggcatgttcaagggttttatcgat
ctggtattcgaacatcaggggcgttactacgtggcggattacaaatccaactggctcggc
agcgacgacattgcttacacccgtgaagcgatggagtccgccatcgccagccaccgctat
gacctgcaatacgtgctctatgtgctggctctgcatcgacagctgcgtctgcgtctgccg
gattacgactatgaccggcatttgggcggcgcgctctacctgttcctgcgggcgccgcag
caaggcgcctacttggcgcgaccgccgcgcgcgttgatcgagcatctggacgtgctgttc
atgggtgaagccgaggagggcgcagcatga

DBGET integrated database retrieval system