KEGG   Pseudomonas pseudoalcaligenes: BN5_2805Help
Entry
BN5_2805          CDS       T03772                                 

Gene name
surE
Definition
(GenBank) 5'-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
ppse  Pseudomonas pseudoalcaligenes
Pathway
ppse00230  Purine metabolism
ppse00240  Pyrimidine metabolism
ppse00760  Nicotinate and nicotinamide metabolism
ppse01100  Metabolic pathways
ppse01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppse00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BN5_2805 (surE)
   00240 Pyrimidine metabolism
    BN5_2805 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BN5_2805 (surE)
Enzymes [BR:ppse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BN5_2805 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: CDM41365
UniProt: W6QWX7
Position
complement(2929412..2930161)
Genome map
AA seq 249 aa AA seqDB search
MRILISNDDGVNAPGIAALHQALADYAECVVIAPGEDRSGASSALTLDRPLHPMALANGY
ISLNGTPTDCVHLGLNGLLEQTPDMVVSGINLGANLGDDVLYSGTVAAALEGRFLSKPAF
AFSLLSRLPDNLPTAAYFARKLVEAHERLELPPRTVLNVNVPNLPLEHIRGVQLTRLGHR
ARAAAPVKVVNPRGKEGYWIAAAGDVEDGSQGTDFHAVMQGYVSITPLRLDRTFNEALET
MDGWLEGIF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattctgatttccaacgacgacggggtgaacgcgcccggtatcgctgcgttgcac
caagcgctggccgactatgccgagtgcgtggtgatcgcccctggcgaagacaggagcggt
gccagcagtgcgctgacgctcgaccgtccgctacatcccatggccctggccaatggctac
atcagcctcaatggcacgccgaccgattgcgtgcacctggggctcaatggtctgctcgag
cagacgccggatatggtcgtctccggcatcaacctgggcgccaacctgggcgatgacgtg
ctctattccggtaccgtcgccgccgcgctcgaaggacgtttcctgagcaagccggcgttc
gccttttcgctgttgtcgcgcctgcccgacaatctgccgactgcggcctacttcgcccgc
aagctggtggaggcgcatgagcgccttgaactgccgccgcgtaccgtactcaacgtcaac
gtgccgaacctgccgctggaacatatccgtggtgtgcagctgacccgactcggtcatcgc
gcgcgtgcggcggcgccggtcaaggtggtcaacccgcgtggcaaggaaggttactggatt
gccgccgccggtgatgtcgaggatggcagtcagggcaccgattttcatgccgtgatgcaa
ggttatgtatcgatcacgccgctacggctcgaccgcacgttcaatgaggcccttgaaact
atggatggctggctggagggcatcttctga

DBGET integrated database retrieval system