KEGG   Pseudomonas pseudoalcaligenes: BN5_3773Help
Entry
BN5_3773          CDS       T03772                                 

Gene name
apaG
Definition
(GenBank) Protein apaG
  KO
K06195  ApaG protein
Organism
ppse  Pseudomonas pseudoalcaligenes
Brite
KEGG Orthology (KO) [BR:ppse00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BN5_3773 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: CDM42316
UniProt: W6R7H3
Position
3896118..3896498
Genome map
AA seq 126 aa AA seqDB search
MSDPRYQIDVSVTTRYLAAQSQPEQNRYAFSYTITIVNNGELPAQLLSRHWIITDGDGRV
QEVRGAGVIGQQPHIEPGASHTYSSGTVMTTQVGTMQGSYQMLAEDGKRFDATIAPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccctcgttatcagatcgacgtcagcgtcaccacccgctacctggctgctcaa
tcgcaaccggagcagaaccgctacgcgttctcctacaccatcacgatcgtcaacaacggc
gagctaccggcgcaactgctgtcgcgtcactggatcatcaccgacggcgacggccgcgtg
caggaagtgcgcggcgccggcgtgatcggccagcaaccgcatatcgagcccggcgccagc
cacacctacagcagcggaacggtcatgaccacccaggtcggcaccatgcagggcagctac
cagatgctcgccgaggacggcaaacgcttcgacgcgactatcgcgcccttccgcctggct
gtaccgggagcccttcactga

DBGET integrated database retrieval system