KEGG   Pseudomonas psychrotolerans: BJP27_00675Help
Entry
BJP27_00675       CDS       T05074                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ppsl  Pseudomonas psychrotolerans
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppsl03009]
    BJP27_00675
Enzymes [BR:ppsl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     BJP27_00675
Ribosome biogenesis [BR:ppsl03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BJP27_00675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: APQ10098
Position
140216..141277
Genome map
AA seq 353 aa AA seqDB search
MNTLLLLCRTGFEGEVCAELGERAALLGVPGYARGKPGEAYAEFVCGDAAGAARLMQNLR
FAELIFPRQWSRGAFLDLPEQDRIGPLLECLADYPVCGSLALEMPDTNDGKALSTFCKKF
ERPLTLALRKAGRLVDDPRAPRLQLTFLSGRQVFVGLVEPGNAALWPMGIPRLKFPREAP
SRSTLKLEEAWHQFIPRAEWETRLAPEMRAVDLGAAPGGWTWQLVAREMLVTAVDNGPMN
EALMDTGLVEHLQVDGYAFAPKRPVDWMVCDIVEKPARTAALIERWIGEGHCREAVVNLK
LPMKQRYREVAGILERLHAHFADRGQRVTIGCKQLYHDREEVTCHLRRLDRKP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgaataccctgttgctgctgtgccgtaccggtttcgaaggcgaggtctgcgccgagctc
ggtgagcgggcggcgctgctcggcgtgcccggctatgcccgcggcaagcccggcgaggcc
tatgccgaattcgtctgcggcgatgcggcaggtgctgcccggttgatgcagaacctgaga
ttcgctgagctaatctttccgcgccagtggtcgcgcggcgcctttctcgacctgcccgag
caggatcgcatcggtccgctgctggagtgcttggccgactacccggtttgcggcagcctg
gccctggaaatgcccgacaccaatgacggcaaggccctctccaccttttgcaagaaattc
gaacgacccctgaccctcgccctgcgcaaggccggtcgcctggtggacgacccccgggcg
ccgcgcctgcaactgaccttcctcagcggtcgccaggtcttcgtcgggctggtcgagccg
ggcaatgccgccctctggcccatgggcatcccgcggctgaagtttccccgcgaggcgccc
agtcgctcgaccctcaagctggaagaagcctggcaccagttcattccgcgcgccgaatgg
gagacccgcctggcgccggagatgcgtgccgtggacctgggcgccgcccccggtggctgg
acctggcaactggtggcccgcgagatgctggtgacggcggtggacaacggtcccatgaac
gaggcgctgatggacaccggcctggtggagcatctgcaggtcgacggctacgccttcgcg
cccaagcgcccggtggactggatggtctgcgatatcgtcgagaagcccgcacgcaccgcc
gcgctaatcgagcgttggatcggcgagggccattgccgcgaggcggtggtcaacctcaag
ctgccgatgaagcagcgctatcgcgaggtggccggtatcctcgaacgcctgcacgcgcat
ttcgccgatcgcggccagcgcgtcaccatcggctgcaagcagctctaccacgaccgcgag
gaagtgacctgtcacctgcggcggctggatcggaaaccctag

DBGET integrated database retrieval system