KEGG   Pseudomonas psychrotolerans: BJP27_01975Help
Entry
BJP27_01975       CDS       T05074                                 

Gene name
amiE
Definition
(GenBank) acylamide amidohydrolase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl00330  Arginine and proline metabolism
ppsl00360  Phenylalanine metabolism
ppsl00380  Tryptophan metabolism
ppsl00627  Aminobenzoate degradation
ppsl00643  Styrene degradation
ppsl01100  Metabolic pathways
ppsl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BJP27_01975 (amiE)
   00360 Phenylalanine metabolism
    BJP27_01975 (amiE)
   00380 Tryptophan metabolism
    BJP27_01975 (amiE)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BJP27_01975 (amiE)
   00643 Styrene degradation
    BJP27_01975 (amiE)
Enzymes [BR:ppsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BJP27_01975 (amiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: APQ10331
Position
447152..448195
Genome map
AA seq 347 aa AA seqDB search
MRHGDISSSPDTVGVAVVNYRMPRLHSKTEVLDNARQIAAMIKGMKLGLPGMDLVVFPEY
STMGIMYDRDEMMATAATIPGEETAIFAAACREARTWGIFSLTGERHEEHPHKAPYNTLV
LINDQGEIVQKYRKCIPWCPIEGWYPGDRTYVSEGPKGLKISLIICDDGNYPEIWRDCAM
KGAELIVRCQGYMYPAKEQQVLMAKTMAWANNCYVAVANAAGFDGVYSYFGHSALIGFDG
RTLGECGEEEMGIQYAQLSISQIRDARANDQSQNHLFKLLHRGYTGVYNSGDGDKGVADC
PFDFYRTWVLDAQKAQADVERMTRSTIGVADCPVGELPHPGQERQLG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgccatggcgatatctccagcagccccgacaccgtcggcgtggctgtcgtcaactac
cggatgccacgcctgcacagcaagacggaggtcctggacaatgcccgccagatcgccgcg
atgatcaagggcatgaagctcggcctgccgggcatggacctggtggtgttccccgaatac
agcaccatggggatcatgtacgaccgcgacgagatgatggccaccgccgcgaccatcccc
ggcgaggagacggcgatcttcgccgccgcctgccgcgaggccaggacctggggcatcttt
tcccttaccggtgagcgccacgaggagcatccgcacaaggccccgtacaacaccctggtg
ctgatcaacgaccagggcgagatcgtgcagaagtaccgcaagtgcattccctggtgcccc
atcgaaggttggtatcccggcgaccgcacctatgtcagcgagggtcccaagggcctgaag
atcagcctgatcatctgtgacgacggcaactacccggagatctggcgcgactgcgccatg
aagggcgccgagctgatcgtgcgctgccagggctacatgtatccggccaaggaacagcag
gtgctgatggccaagaccatggcctgggccaacaactgctacgtggcggtggccaatgcc
gccggcttcgacggggtgtacagctacttcggccactcggcgctgatcggcttcgacggc
cgcaccctgggcgaatgcggcgaggaagagatgggcattcagtacgcccagctatcgatc
tcgcagatccgcgacgcccgcgccaacgaccagtcgcagaaccacctgttcaagttgctg
caccgcggctacaccggcgtctacaactccggggatggcgacaagggcgtggccgattgt
cccttcgacttctaccgcacctgggtactggatgcgcagaaggcgcaggcggacgtcgag
cgcatgacccgctccaccattggggtggcggactgtccggtgggcgaactgccccatccg
ggccaggaacgccagctgggctga

DBGET integrated database retrieval system