KEGG   Pseudomonas psychrotolerans: BJP27_02925Help
Entry
BJP27_02925       CDS       T05074                                 

Definition
(GenBank) phosphatase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
ppsl  Pseudomonas psychrotolerans
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJP27_02925
Enzymes [BR:ppsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     BJP27_02925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: APQ10509
UniProt: A0A147H4R4
Position
complement(655463..656335)
Genome map
AA seq 290 aa AA seqDB search
MRVDLHCHTTASDGAFAPAEVVRRAHERGVQLLAITDHDTLDGYAEAMATAESLGVRLLS
GIEMSCTWGGATLHVLGYNFAPDSPTLIAALNALHEGRWERAREIDRRLAAKGMPGTLEG
ARAVQMALGDSRNAPARPHFAEYLVQAGHVEDRGDAFRKWLGGGKLGDVKQHWPTLAETL
DTLKAAKAWISLAHPLAYGFTRTKLRKLIGEFVTGGGHAIEVVNGVQPAEQVGTLAILAR
EFGLMVSAGSDFHAPADWSELGMYRPLPEDLPPLWARFSQPLYPQNREPQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcgacctgcactgtcataccaccgcgtccgacggcgccttcgcgcccgccgag
gtggtcaggcgtgcccacgagcgtggcgtccaactgctggcgattaccgatcacgacacc
ctggatggctatgccgaagcgatggcgacggcggagagcctgggagtcaggctgctgtcg
ggaatcgagatgtcctgtacctggggtggtgcgacgctgcacgtgctgggctataacttc
gcgcccgactccccaacgctgatcgcggcgctgaatgcgttgcacgagggtcgctgggag
cgcgcgcgggaaatcgaccggcggctggccgccaagggtatgcccggtaccctggaaggt
gcccgggcggtgcagatggccctcggtgatagccgtaatgcgccggcacgaccacatttc
gccgaatacctggtgcaggcgggtcacgtcgaggataggggcgatgccttccgcaagtgg
ctgggcggtggcaagctcggcgacgtcaagcagcactggccgaccctggccgaaaccctg
gatacgctcaaggcggccaaggcctggatcagtctggcgcatccactggcctacggtttc
acgcgcaccaagttgcgcaagctgattggcgaattcgtgaccggcggtggccatgccatc
gaggtcgtcaatggcgtgcagccggccgagcaggtcggcaccctggcaattctggcgcgg
gaattcggtctgatggtgagtgcgggcagcgatttccacgccccggccgactggtcggag
ctggggatgtaccgcccgttgcccgaagatctgccgccactctgggcgcgcttcagtcaa
ccgctgtacccacagaatcgggaaccccaatga

DBGET integrated database retrieval system