KEGG   Pseudomonas psychrotolerans: BJP27_03310Help
Entry
BJP27_03310       CDS       T05074                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BJP27_03310
Enzymes [BR:ppsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BJP27_03310
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BJP27_03310
    1.1.1.-  
     BJP27_03310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc TrkA_N
Motif
Other DBs
NCBI-ProteinID: APQ10581
Position
735848..736912
Genome map
AA seq 354 aa AA seqDB search
MKAARFHAARDIRVEDVPPPGAPGPTQVLVRNQFCGICGTDLHEYVGGPIFIPTAPHSYT
GGQVPQILGHEYSGVVEAVGNQVTAVKPGDRVSIQPMVSPRDDYYGRRGQYQLSEQLAII
GLSHPWGGMAEYSLVEDYNAIPMPDNLSTEHAALIEPTAVTVYATHRGGVKPGDSVLVAG
AGPIGQLQVLAARAAGATRIFLVDLNDNRLEMAHRLVDGLITLNPGSTDVLREVRAHTAG
GVGVDVAFECVGAEAPLGLCLEAVRRQGVVVQVGMQGKPPALDGFTLTYKDVDLRGSWCY
STLMWPQVAALIASGQLPAEKIVTRHIALDEVVEQGFEALLDKGGTQLKILIEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctcgtttccatgccgcccgcgatatccgggtggaagacgtcccaccgccc
ggcgcgcctggccccacccaggtgctggtcagaaaccagttctgcggtatctgcggcacc
gatctgcacgaatatgtcggtggccccatcttcatccccaccgcgccgcactcctatacc
ggcggccaggtgccgcagatcctcggccatgagtattccggggtggtggaagccgtgggc
aaccaggtgacggcggtgaagcccggcgaccgggtgtccatccagcccatggtctcgccg
cgcgacgactactacgggcggcgcggccagtaccagctcagcgaacaactggcgatcatc
ggcctgtcccacccctggggcggcatggccgagtactccctggtggaggactacaacgcc
atccccatgccggacaacctcagcaccgagcatgcggcgctgatcgagcccacggcggtg
accgtctacgccacccacaggggcggggtgaagccgggcgacagcgtgctggtggccggc
gccgggcccatcggccagctccaggtgctggccgcccgcgccgctggggccacccgcatc
ttcctggtggacctcaacgacaatcgcctggaaatggcccatcgcctggtggacggcctc
atcaccctgaaccccggcagcaccgacgtcctgcgcgaggtgcgcgcccacaccgccggt
ggcgtgggggtggacgtggccttcgaatgcgtgggcgccgaggcgccgctggggctatgc
ctggaggccgtgcgccgccagggcgtggtggttcaggtggggatgcagggcaagcccccg
gcgctggatggcttcaccctcacctacaaggacgtcgacctgcgcggttcctggtgctac
tcgacgctgatgtggccgcaggtggccgcgctcatcgccagcgggcagctaccggcggag
aagatcgtcacccgccacatcgccttggacgaggtggtggaacagggcttcgaggcactg
ctcgacaagggcggtacccagctgaagattctgatcgagttgtga

DBGET integrated database retrieval system