KEGG   Pseudomonas psychrotolerans: BJP27_08830Help
Entry
BJP27_08830       CDS       T05074                                 

Definition
(GenBank) dihydromonapterin reductase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl00670  One carbon pool by folate
ppsl00790  Folate biosynthesis
ppsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BJP27_08830
   00670 One carbon pool by folate
    BJP27_08830
Enzymes [BR:ppsl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BJP27_08830
    1.5.1.50  dihydromonapterin reductase
     BJP27_08830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: APQ11601
Position
1962818..1963516
Genome map
AA seq 232 aa AA seqDB search
MSAALPLLVTGANRRVGLALTRRLLAAGQPVIAVYRDDPGPLRELEIEAYQVDLAEEQQR
DVLLQQLHERHGALRGVIHNASVWAEDGLDNLRLLYRLHLEAPYHLNLGLQDLLLAAPRA
DIIHIGDDSATRGSRNHIGYAATKAALHNLTLSFAEALAPTVRVNTIAPGLLIFKEGADE
AYRQATLDKALLDFEPGADPIVDTVLYLLSTAYATGSTFTVNGGRHLRHGRR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagcccttccccttctggtaaccggcgccaatcgccgcgttggcttagccctc
acccgtcgtcttctggcggcaggccagccggtcatcgcggtctaccgcgacgatccgggt
ccgttgcgcgagctggagatcgaggcctatcaggtcgatctggctgaggaacagcagcgc
gacgtcctgttgcaacaactccatgaacgccatggggcactgcgcggggtgattcacaac
gcctcggtctgggcggaagatggcctggacaatctgcgcctgctctatcgcctgcacctg
gaagcgccctaccacctgaacctgggcctgcaggatctgctgctggccgctccgcgcgcc
gacatcatccacatcggcgacgacagcgcgacgcgtggcagccgcaaccacatcggctac
gctgccaccaaggctgccctgcacaacctgaccctgtcattcgccgaagccctggcgccc
accgtcagggtcaacaccatcgcgccgggcctgctgatcttcaaggaaggcgccgacgag
gcctatcgccaggcgaccctggacaaggccttgctggatttcgaacccggcgccgatccc
atagtggataccgtgctctatctgctgtcgacggcctatgcgaccggcagcaccttcacc
gtcaacggcgggcgccacctgcgccatggccgccgctag

DBGET integrated database retrieval system