KEGG   Pseudomonas psychrotolerans: BJP27_12300Help
Entry
BJP27_12300       CDS       T05074                                 

Definition
(GenBank) fructose-1,6-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ppsl  Pseudomonas psychrotolerans
Pathway
ppsl00010  Glycolysis / Gluconeogenesis
ppsl00030  Pentose phosphate pathway
ppsl00051  Fructose and mannose metabolism
ppsl00680  Methane metabolism
ppsl01100  Metabolic pathways
ppsl01110  Biosynthesis of secondary metabolites
ppsl01120  Microbial metabolism in diverse environments
ppsl01130  Biosynthesis of antibiotics
ppsl01200  Carbon metabolism
ppsl01230  Biosynthesis of amino acids
Module
ppsl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJP27_12300
   00030 Pentose phosphate pathway
    BJP27_12300
   00051 Fructose and mannose metabolism
    BJP27_12300
  09102 Energy metabolism
   00680 Methane metabolism
    BJP27_12300
Enzymes [BR:ppsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BJP27_12300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: APQ12243
UniProt: A0A147H0N6
Position
complement(2733990..2735054)
Genome map
AA seq 354 aa AA seqDB search
MALVSMRQLLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPVIVQASAGARKYAGAP
FLRHLILAAVEEFPHIPVVMHQDHGTSPDVCQRSIQLGFSSVMMDGSLKADGKTPSDYDY
NVRVTQQTVAFAHACGVSVEGELGCLGSLETGMAGEEDGVGAEGTLDHSQLLTDPEEAAQ
FVKATKVDALAIAIGTSHGAYKFTKPPTGDTLSIQRIKEIHARIPDTHLVMHGSSSVPQE
WLKIINEYGGDIKETYGVPVEEIVEGIKYGVRKVNIDTDLRLASTGAIREFMAKNPAEFD
PRKYLAKTVTAMRDICIARYEAFGTAGQASKIKPISLDAMFERYARGELDPKVN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcactcgtcagcatgcgtcagctgctggatcacgccgccgaattcggctacggcgtc
ccggctttcaacgtcaacaacctcgagcagatgcgcgccatcatggaagccgccgacaag
accgattcgccggtcatcgtccaggcctccgccggtgcccgcaagtacgccggcgctccc
ttcctgcgtcacctgatcctggctgcggtggaagaattcccgcacatcccggtggtcatg
caccaggaccacggcaccagccccgacgtctgccagcgctccatccagctgggcttctcc
tcggtgatgatggacggctcgctcaaggccgacggcaagaccccgtccgactacgactac
aacgtgcgcgtcacccagcagaccgtggccttcgcccatgcctgcggcgtgtccgtggag
ggcgagctgggttgcctgggcagcctggaaaccggcatggccggtgaagaagacggcgtt
ggcgccgagggcaccctggatcacagccagctgctgaccgatccggaagaagccgcccag
ttcgtcaaggccaccaaggtcgacgccctggccatcgccatcggcaccagccacggcgcc
tacaagttcaccaagccgccgaccggggacaccctgtcgatccagcgcatcaaggaaatc
catgcgcgcatcccggacacccacctggtcatgcacggctccagctcggtgccccaggag
tggctgaagatcatcaacgagtacggtggtgacatcaaggaaacctacggtgtgccggtc
gaggagatcgtcgaaggcatcaaatacggcgtgcgcaaggtcaacatcgacaccgacctg
cgcctggcgtccaccggtgccatccgcgagttcatggccaagaaccccgccgagttcgac
ccgcgcaagtacctggccaagaccgtgaccgccatgcgcgacatctgcatcgcccgttac
gaagccttcggcaccgccggccaggcctccaagatcaagccgatctccctggacgccatg
ttcgagcgctatgcccgcggcgagctggatcccaaggtcaactga

DBGET integrated database retrieval system