KEGG   Pseudomonas psychrotolerans: BJP27_16150Help
Entry
BJP27_16150       CDS       T05074                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ppsl  Pseudomonas psychrotolerans
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BJP27_16150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: APQ12962
UniProt: A0A147H8D3
Position
complement(3596497..3596883)
Genome map
AA seq 128 aa AA seqDB search
MTESDPRYLITVQVTTRYLPEQSSTSQERYAFAYDVSIRNDGSLPAQLLSRHWIITDGNG
EVQEVRGPGVVGEQPLIAPGETHSYSSGTLMPTQVGSMSGSYQMVASDGHGFEAAIPTFR
LAVPGSLH
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagtccgatccgcgctacctcatcaccgtgcaggtcaccacccgctacctgccc
gaacaatccagcaccagccaggaacgctatgccttcgcctacgacgtgagcatccgcaac
gacggcagcctgccggcgcagttgctcagccgccattggatcatcaccgacggcaacggc
gaggtgcaggaagtccgcgggccgggcgtggtgggtgagcaaccgttgatcgcgccgggc
gagacccatagctactccagcggcaccctgatgccgacccaggtgggcagcatgagcggc
agctaccagatggtcgccagtgacggccatggcttcgaagccgccatccccaccttccgc
ctggccgtacccggctcgttacactag

DBGET integrated database retrieval system