KEGG   Pseudomonas psychrotolerans: BJP27_19695Help
Entry
BJP27_19695       CDS       T05074                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ppsl  Pseudomonas psychrotolerans
Brite
KEGG Orthology (KO) [BR:ppsl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppsl03009]
    BJP27_19695
Enzymes [BR:ppsl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     BJP27_19695
Ribosome biogenesis [BR:ppsl03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BJP27_19695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 MTS Methyltransf_32 Methyltransf_2 Methyltransf_4 Methyltransf_33 NodS Methyltransf_18 MetW
Motif
Other DBs
NCBI-ProteinID: APQ13607
Position
complement(4365148..4365960)
Genome map
AA seq 270 aa AA seqDB search
MKLICPLCQAPLAELDGGVGCPAGHRFDRARQGYLNLLPVQHKKSLDPGDNAAMVEARRR
FLDAGHYAPLAERLAQLAAERAPQRWIDVGCGEGFYTERLAQALPTADGYALDISREAVR
RACRRTPALTWLVASMARIPLPDASCQLLASVFSPIDWSEAQRVLATGGGILRLGPATAH
LLELRQRLYDEVRDYAEDKHLQDLPPGLELAHSEGLEFVLPLTERQTREDLLAMTPHGWR
VNAERRERVLAEPFEVRVAVRYDWIVKSGA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatctgtccgctctgccaggcgccgttggccgaactcgatggtggcgtcggc
tgccccgccggccataggttcgaccgtgcccgccagggctatctgaatctcttgccggtg
cagcacaagaagagcctggacccgggcgataacgccgccatggtcgaggcccgtcggcgc
ttcctcgatgccggtcactacgcgccgctggccgaacgcctggcgcagctggctgccgaa
cgcgcaccgcagcgctggatcgacgtcggctgcggcgaaggcttctataccgagcgcctg
gcccaggccctgcccacggccgatggctacgccctggacatctcccgcgaggcggtacgc
cgcgcctgccggcgcacgccggccctgacctggctggtggcgagcatggcgcgcatcccg
ctgccggacgccagttgccagctgctggccagcgtcttcagccccatcgactggagcgaa
gcccagcgcgtactggccaccggtggcggcatcctgcgcctgggtccggccaccgcccac
ctgctggagttgcgtcagcgcctctacgacgaggtgcgcgactacgccgaagacaagcac
ctgcaggatctgccgccaggactggaactggcccacagcgaagggctcgaattcgtgctg
ccgctgaccgagcgccagacccgcgaagacctgctggccatgacgccccacggctggcgg
gtcaacgccgagcgccgcgagcgagtgctggccgagcccttcgaagtgcgggtggcagta
cgttacgattggatcgtcaaatccggagcctaa

DBGET integrated database retrieval system