KEGG   Pseudomonas versuta: AOC04_02680Help
Entry
AOC04_02680       CDS       T04081                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00860  Porphyrin and chlorophyll metabolism
ppsy01100  Metabolic pathways
Module
ppsy_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AOC04_02680
Enzymes [BR:ppsy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AOC04_02680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB CLP1_P BPL_N
Motif
Other DBs
NCBI-ProteinID: ALE87200
UniProt: A0A0M5LV37
Position
573401..574852
Genome map
AA seq 483 aa AA seqDB search
MSTLMVQGTTSDAGKSTLVTALCRWLTREGVRVVPFKPQNMALNSAVTAEGGEIGRAQAV
QAQAAGLAPHTDMNPVLLKPNSDTGAQVIIHGRAVTSMNAVAYHDYKAIAMQAVLASHQR
LSAEYPVVMVEGAGSPAEINLRAGDIANMGFAEAVDCPVILIADINRGGVFAHLVGTLEL
LSETEQARVKGFIINRFRGDIALLQPGLDWLEQRTGKPVIGVLPYVMDLHLEAEDGIDQR
QTDKVDQVLKVVVPVLPRISNHTDFDPLRLHPQVDLQFVGPGQPVPAADLIILPGSKSVR
SDLAYLRGNGWEAAINRHLRYGGKLLGICGGLQMLGEQVHDPLGLEGAAGSSPGLGLLAL
STELAAEKQLRNVRGHLTLENAAVSGYEIHAGVTSGVALERPAVQLEDGRCDGAQSEDGQ
IFGTYLHGLFESPAACSALLRWAGLQDVQTVDYHALRERDIERLADLVQNHLDTGLLRQL
CGL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgctgatggtgcagggcactacatccgatgcgggtaaaagtactctggtcacg
gcattgtgccgctggctgacccgcgagggtgtgcgtgtggtgccgttcaagccgcagaac
atggcgctcaacagtgccgtcaccgcagagggcggcgagatcggtcgggcccaggcagtc
caggcccaggcggccggtcttgcgccccacacagacatgaatccggtgttgctcaagccc
aacagtgacaccggcgcgcaggtgattattcatgggcgtgccgtaaccagcatgaacgcg
gtggcttatcacgactacaaggccatcgccatgcaggcggtgctggcctcgcaccaacgc
ttgagcgccgagtacccggtggtgatggtcgagggcgcgggctcgcctgccgagatcaat
ctgcgtgccggcgacatcgccaacatgggctttgccgaggcggtggattgtccggtaatc
ctgatcgccgacatcaatcgcggcggcgtgtttgcgcatcttgtcggcactcttgagttg
ctgtcagagaccgagcaggcgcgggtcaaaggcttcatcatcaaccgttttcggggcgac
attgccttgctccagcctggtctcgactggcttgaacagcgcacgggcaagccggtgatc
ggtgtattgccgtatgtgatggatttgcatcttgaggctgaagacggcattgaccagcgc
cagaccgacaaggtagatcaagtgctcaaggtggttgtgccggtactgccgcgtatcagt
aaccacaccgacttcgatccgctgcgtttgcacccgcaagtggacttgcagtttgtcggg
ccgggccagcctgtccctgctgcggatttgattatcctgccgggctccaaaagcgtgcgc
agcgatctggcctatttgcgcggcaatggctgggaggcggcaatcaaccgtcacttgcgc
tatggcggcaagttgctggggatttgtggcggtttgcagatgctcggcgaacaggttcac
gacccgctggggctcgaaggcgcggcggggtcgagccccggtctggggttgctggcattg
agcaccgagcttgccgccgagaagcaactgcgcaatgtacgcgggcatctgaccctggaa
aacgctgcagtcagtggctacgaaatccatgccggcgtgactagcggcgtggcgctggag
cggccggcggtgcagttggaagatggccggtgtgatggcgcccagagtgaagacgggcaa
attttcggcacgtacttgcatggtttgttcgagtcacctgcggcctgcagtgccttgttg
cgctgggccggtttgcaggacgtgcaaacggtggactaccacgccctgcgtgagcgggac
atcgagcgcctggcggacctggtgcaaaaccatcttgataccgggttgctgcgtcaatta
tgcgggctctga

DBGET integrated database retrieval system