KEGG   Pseudomonas versuta: AOC04_02715Help
Entry
AOC04_02715       CDS       T04081                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00480  Glutathione metabolism
ppsy00590  Arachidonic acid metabolism
ppsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AOC04_02715
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AOC04_02715
Enzymes [BR:ppsy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AOC04_02715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ALE87206
UniProt: A0A0M4R278
Position
579768..580319
Genome map
AA seq 183 aa AA seqDB search
MLKRWIAMPVLLLVCTGSVWAAQCPPLLEGSLPKLRAKESIDLCQRFAAKPLLIVNTASF
CGFAPQFKGLEALHQRFKGQGLELIGVPSNDFKQEAKDGEETAKVCYVNYGVTFTMIDPQ
HVRGPDAVHLFKVLAEQSSAPKWNFYKYVVDRKGNVIANFSSLSKPDSPELIEAIEKAIA
STP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagcgctggattgcaatgcccgtattgttgttggtttgcaccggttctgtatgg
gcggcgcagtgtccgccgctactggaaggctcattgccaaagttgcgggccaaagaatct
atcgatctgtgccagcgcttcgccgcaaagccgctgttgatcgttaatactgcgagcttt
tgtggctttgcccctcagttcaaagggcttgaggcattgcatcagcgttttaaagggcag
gggctggagttgattggcgtgccgtccaatgactttaaacaagaggccaaggacggcgaa
gaaacagccaaggtctgttacgttaattacggtgtaacgttcaccatgattgatccgcaa
catgttcgtggtcctgacgcagtgcatttgtttaaagtgctggctgagcagagcagtgcg
ccgaagtggaatttctacaaatatgttgtagatcgcaaaggcaatgtcattgccaacttt
tcgagtctgagtaaacccgacagccccgaattgattgaggcgatagaaaaagccattgct
tcaacaccctga

DBGET integrated database retrieval system