KEGG   Pseudomonas versuta: AOC04_05125Help
Entry
AOC04_05125       CDS       T04081                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
ppsy  Pseudomonas versuta
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppsy03009]
    AOC04_05125
Enzymes [BR:ppsy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     AOC04_05125
Ribosome biogenesis [BR:ppsy03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AOC04_05125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: ALE87642
UniProt: A0A0M4Q8A1
Position
1122969..1124045
Genome map
AA seq 358 aa AA seqDB search
MNTVFMHCRPGFEGEVCSEIAEHAARLNVSGYAKAKPSSACAEFVCTQEGGAERLMRGLR
FVELIFPRQWARGGFIELPETDRISVILQHMADFPVCGSLWLEMVDTNDGKELSNFCKKF
DAHLRKALIKAGKLVEDDELKPRLLLTVKSGRELFLGLAESNNCAMWPMGIPRLKFPREA
PSRSTLKLEEAWHHFIPRDQWDERLHSDMTGVDLGAAPGGWTWQLVNRGMIVTAIDNGPM
AESLMDTGLVQHLMADGFTFKPKQPVDWMVCDIVEKPARNAAMLEEWIGEGHCREAVVNL
KLPMKQRYAEVRRLLDRIADGFKERGIQVEIGCKQLYHDREEVTCHLRRLDVKKTKSR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgtttttatgcattgccggcccggttttgaaggcgaagtctgctccgaaatc
gccgagcatgctgcccgcctcaatgtctctggttatgccaaggccaagccaagcagtgcc
tgtgccgaatttgtctgtactcaagaaggcggcgccgaacgcctgatgcgcggcttgcgt
tttgtcgaactgattttcccgcgtcagtgggcccggggcggttttatcgaactgccggaa
accgaccggatcagcgtcattcttcagcacatggccgactttccggtctgtggcagcctg
tggctggaaatggtcgacaccaatgacggcaaagagctgtccaacttctgcaagaagttc
gatgcccatttgcgcaaggccctgatcaaggccggcaagctggtagaggacgatgagctc
aagccgcggttgctgctgaccgttaaaagtggtcgcgaactgttcctcggcctggccgag
tcgaacaactgcgccatgtggccaatgggcatcccgcggttgaaattcccccgtgaggcg
ccgagccgttcgaccctcaaactggaagaggcgtggcatcattttatcccccgtgaccag
tgggatgagcgcctgcacagtgacatgaccggagttgaccttggcgctgcgcccggtggc
tggacctggcagctggtcaatcgcggcatgatcgttaccgccatcgacaacggcccgatg
gccgaaagcctgatggacaccggtttggtgcagcacttgatggcggatggttttaccttc
aagcccaagcagccagtggactggatggtctgcgacatcgtggaaaagcctgcccgcaat
gcggcgatgcttgaagagtggatcggcgaaggtcactgtcgcgaagcggtggtcaacttg
aaattgccgatgaaacagcgttatgccgaagtgcggcgcttgcttgatcgcattgctgac
ggtttcaaggagcgcggtatccaggtcgaaattggctgcaagcagctgtaccacgaccgc
gaagaagtgacctgccatttgcgtcgactggacgtgaaaaaaaccaaatcccgttga

DBGET integrated database retrieval system