KEGG   Pseudomonas versuta: AOC04_06375Help
Entry
AOC04_06375       CDS       T04081                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00071  Fatty acid degradation
ppsy00072  Synthesis and degradation of ketone bodies
ppsy00280  Valine, leucine and isoleucine degradation
ppsy00310  Lysine degradation
ppsy00362  Benzoate degradation
ppsy00380  Tryptophan metabolism
ppsy00620  Pyruvate metabolism
ppsy00630  Glyoxylate and dicarboxylate metabolism
ppsy00640  Propanoate metabolism
ppsy00650  Butanoate metabolism
ppsy00900  Terpenoid backbone biosynthesis
ppsy01100  Metabolic pathways
ppsy01110  Biosynthesis of secondary metabolites
ppsy01120  Microbial metabolism in diverse environments
ppsy01130  Biosynthesis of antibiotics
ppsy01200  Carbon metabolism
ppsy01212  Fatty acid metabolism
ppsy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AOC04_06375
   00630 Glyoxylate and dicarboxylate metabolism
    AOC04_06375
   00640 Propanoate metabolism
    AOC04_06375
   00650 Butanoate metabolism
    AOC04_06375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOC04_06375
   00072 Synthesis and degradation of ketone bodies
    AOC04_06375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOC04_06375
   00310 Lysine degradation
    AOC04_06375
   00380 Tryptophan metabolism
    AOC04_06375
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AOC04_06375
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOC04_06375
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AOC04_06375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppsy04147]
    AOC04_06375
Enzymes [BR:ppsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AOC04_06375
Exosome [BR:ppsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOC04_06375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALE87851
UniProt: A0A0M4RFZ1
Position
1417445..1418596
Genome map
AA seq 383 aa AA seqDB search
MPQAYIVDALRSPTGRRKGGLAHVHAMDLGAHVLKALVERNQIPADEYDDVIFGCVDTIG
SQAGDIARTSWLAAGLPLNVPGTTIDRQCGSSQQALHFAAQAVMSGTQDVIAVGGVQTMT
QIPISSAMLAGQALGFSDPFSGSKGWQARFGNQSVNQFYAAQRIADHWDISRQQMEAYAL
ESHRRALDAIAGRRFVNEIVPCEGVWDDETPRHTSLAKMAELEPVSAEFPSITAAVSSQT
CDASAALLVVSEAALKRYNLTPRARIHHLSVLGDDPIWHLTAPIAATRAALKKAGMNIND
IDLVEINEAFASVVMAWAKELDYDPARTNANGGAIALGHPLGASGARLMTSLLHQLERSG
GRYGLQTMCEGGGQANVTIIERL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgccccaagcctatattgttgatgccttgcgcagcccgaccggcaggcgcaagggcggt
ctggcccatgtccacgcgatggacctgggcgcccatgtgctcaaggcgttggttgagcgc
aaccagattccggccgacgaatacgacgacgtgatctttggctgtgtcgataccattggc
tcgcaagcgggagatattgcccgcaccagctggctggccgccggtttgccgctcaatgtg
cccggcaccaccattgatcgtcagtgcggctcgtcgcaacaggcgctgcactttgccgcc
caggcggtgatgagtggcacccaggatgtgatcgcggtgggcggtgtgcaaaccatgacc
cagatcccgatttcctcggcgatgctggccgggcaggcactgggtttcagcgatccgttt
tccggcagcaagggctggcaggcgcgctttggcaaccaatcggtcaaccagttttatgcg
gcgcagcgaatagccgaccactgggatatcagccgccagcagatggaagcctacgcgctg
gaaagccatcgccgggcactggatgccatcgccgggcgccgcttcgtcaatgaaatcgtg
ccctgcgaaggggtgtgggacgatgaaacaccgcgccacactagtctggccaaaatggcc
gaactggagccggtgtctgccgagttcccttcgattaccgcagcggtttccagccagacc
tgcgacgcctcggcggccttgctggtggtctcggaagcggcgctcaagcgctacaacctg
acgcctcgggcacggatccatcatctctcggtgctcggcgacgacccgatctggcacctc
acggcacccattgccgcgacccgtgccgcgctgaaaaaagccggcatgaacatcaacgac
atcgacttggtggaaatcaacgaagcctttgcctcggtggtcatggcctgggccaaagag
ctggattacgacccggccaggaccaacgccaatggcggggcgatcgccctgggccatccg
ctgggtgccagcggcgcacggttgatgaccagcctgctgcaccagcttgagcgcagtggc
ggccgttacggcttgcagaccatgtgcgaaggcggcgggcaagccaacgtgaccatcatt
gagcgtctctag

DBGET integrated database retrieval system