KEGG   Pseudomonas versuta: AOC04_06490Help
Entry
AOC04_06490       CDS       T04081                                 

Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00450  Selenocompound metabolism
ppsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AOC04_06490
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppsy03016]
    AOC04_06490
Enzymes [BR:ppsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     AOC04_06490
Transfer RNA biogenesis [BR:ppsy03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    AOC04_06490
 Prokaryotic Type
    AOC04_06490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ALE87874
UniProt: A0A0M5LZL7
Position
1442940..1443974
Genome map
AA seq 344 aa AA seqDB search
MSEPIRLTQYSHGAGCGCKISPQVLEVILAGSGAQNLDPKLWVGNASRDDAAVYALDDER
GVVSTTDFFMPIVDDPYDFGRIAATNAISDIYAMGGDPLMAIAILGWPVHLLPPEVAREV
IRGGRAVCDEAGIPLAGGHSIDTPEPIFGLAVTGVVNKRHMKRNDTAVAGCLLYLTKPLG
IGILTTAEKKGKLRSEDVGVARDWMCTLNRIGSQFAKLEGVKAMTDVTGFGLLGHLVEMA
DGSNLTAKIQYAKVPQLASVEYYLEQGCVPGGTLRNFDSYASKLAPLQQLHKLVLCDPQT
SGGLLVAVSPQGDQAFLEMAREHGLELESIGQLVERQTYAVEVS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgattcgtctgacccagtacagccacggtgcgggctgtggctgcaagatt
tcgcctcaggtactggaagtaatccttgccggcagcggagcgcaaaatcttgaccccaag
ctctgggtaggcaatgcctcccgcgacgatgcagcggtctatgcactggatgatgagcgc
ggcgtggtttcgaccaccgacttttttatgcccatcgttgatgacccttatgatttcggg
cggattgcagccaccaatgccatcagtgacatctacgcgatgggcggcgatcccttaatg
gcgattgcgattttaggctggccggttcatttgttgccgccagaagtggcccgcgaagtg
attcgcggtggccgcgcggtatgcgatgaagcgggtattccgctggctggcggtcactcc
attgacaccccggaaccgattttcgggctggcggtgaccggtgtggtcaacaagcgccac
atgaagcgcaacgacacggccgtcgccggttgcctgttgtacctcaccaagcccctgggg
atcggcatccttaccactgccgagaaaaagggcaagctgcgcagcgaagacgtcggcgtg
gcacgggactggatgtgcacccttaacaggatcggcagccagttcgccaaactcgaaggg
gtcaaggcgatgaccgatgtcaccggtttcggcctgctcgggcatttggtggaaatggcc
gatggcagcaacctgacagcgaaaatccagtacgccaaagtgccgcaactggcctcggtc
gagtactacctggaacaaggctgtgtgcccggcggcaccttgcgcaatttcgacagttac
gcgagcaagcttgcgccgctgcaacaactgcacaagctggtactgtgtgatccgcaaacc
agcggtggactgctggtggccgtcagcccgcagggcgatcaggcgttcctggagatggct
cgcgagcacgggctggagctggagtccatcggccaactggttgagcgacagacgtacgcg
gttgaggtgtcatga

DBGET integrated database retrieval system