KEGG   Pseudomonas versuta: AOC04_10350Help
Entry
AOC04_10350       CDS       T04081                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00020  Citrate cycle (TCA cycle)
ppsy00620  Pyruvate metabolism
ppsy01100  Metabolic pathways
ppsy01110  Biosynthesis of secondary metabolites
ppsy01120  Microbial metabolism in diverse environments
ppsy01130  Biosynthesis of antibiotics
ppsy01200  Carbon metabolism
Module
ppsy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppsy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOC04_10350
   00620 Pyruvate metabolism
    AOC04_10350
Enzymes [BR:ppsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AOC04_10350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo
Motif
Other DBs
NCBI-ProteinID: ALE88570
UniProt: A0A0M5M203
Position
complement(2335249..2336895)
Genome map
AA seq 548 aa AA seqDB search
MLKKMNKGLLGLALTMGLTSVQAAETKQVDVLLIGGGIMSATLGVWLNELEPGMSMEMIE
RLDGVALESSNGWNNAGTGHSALAELNYTPEDKNGNVEIPKAIEINEAFQVSRQFWSWQV
KNGVLKDPRSFINSTPHMSFVWGDDNIKFLKKRYEALQASPLFAGMQYSEDPVQIKKWVP
LMMEGRDPNQKVAATWSPIGTDVNFGEITRQFAAYLQTKPNFSLKLSSEVKDITRNDDGT
WHVVYKNLKDGSETATDAKFVFIGAGGGALHLLQKSGIPEAKEYAGFPVGGSFLVTDNPT
VAQQHLAKAYGKASVGAPPMSVPHLDTRVLDGKRVILFGPFATFSTKFLKEGSYFDLLTS
TTPHNIWPMTKVGIEQYPLVEYLAGQLMLSDEDRFNALKEYFPNAKSEDWRLWQAGQRVQ
IIKRDEEKGGVLKLGTEIVSAKDGSIAGLLGASPGASTAAPIMLTVLETVFKDKVASPEW
QAKLHQIVPSYGTKLNGDPDRVAKEWAYTAEVLQLTPPPAIPAATHTATPSDAQAKPAPG
NPAADMAL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaaatgaataaggggctactgggcctggcgctgaccatggggcttacgtcc
gtgcaggctgccgagaccaaacaggttgatgtgctgctgatcggtggcggcatcatgagc
gcaaccctgggtgtctggctcaatgagctggaaccgggcatgtcgatggagatgatcgaa
cgtctcgacggcgtggcactcgaaagctccaacggctggaacaacgcgggtaccggtcac
tcggctctggccgagctgaactacacccccgaagacaagaacggcaatgtagaaatcccg
aaggccattgaaatcaatgaagccttccaggtatcgcgtcagttctggtcgtggcaggtc
aagaatggcgtgctgaaagatccgcgttcgttcatcaactccactccgcacatgagcttt
gtgtggggcgatgacaacatcaagttcttgaagaagcgctacgaagcactgcaggcgagc
ccgctgttcgccggtatgcagtactccgaagacccggttcagatcaagaagtgggttccg
ctgatgatggaagggcgtgacccgaaccagaaagtcgcggccacctggtctccgatcggt
accgacgtgaacttcggcgaaattacccgccagttcgcggcttacctgcaaaccaagccc
aacttctcgctgaagctgtcgagtgaagtcaaggacatcacgcgcaacgatgacggcacc
tggcatgtggtttacaagaacctgaaagacggttccgaaacggccaccgacgccaagttt
gtgtttatcggcgccggcggcggtgcactgcacctgctgcagaagtccggcattcctgaa
gccaaggagtacgcaggcttcccggttggcggctcgttcctggtaaccgataacccgact
gttgcccagcagcatttggccaaggcttacggcaaggcttcggttggcgcgccaccgatg
tcggttcctcacctggacacccgcgtgctcgatggcaagcgtgtgattctgtttggcccg
ttcgccaccttctccaccaagttcctcaaggaaggctcgtacttcgacctgctgaccagc
accactccccacaacatctggccaatgaccaaagtcggtatcgaacagtacccactggtt
gagtacctggccggccagctgatgctgtcggacgaagaccgcttcaacgcgctgaaagag
tacttcccgaacgccaagtctgaagactggcgcctgtggcaagccggccagcgtgtgcag
atcatcaagcgtgatgaagagaagggcggcgtattgaaactcggtaccgagatcgtcagc
gccaaagatggcagcatcgccggtctgctgggcgcttcgcctggtgcatcgaccgctgct
ccgatcatgctgaccgtgcttgaaaccgtgttcaaggacaaggtggccagccctgagtgg
caagccaagctgcaccagatcgtgccgagctatggcaccaagctcaatggcgatccggat
cgtgttgcaaaggaatgggcctacaccgccgaagtcctgcaactgactccgccaccggcg
atcccggcagcaacccatactgcgaccccgtctgacgcacaggccaagcctgcgccaggc
aatccagcggccgacatggcgctgtaa

DBGET integrated database retrieval system