KEGG   Pseudomonas versuta: AOC04_10415Help
Entry
AOC04_10415       CDS       T04081                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00860  Porphyrin and chlorophyll metabolism
ppsy01100  Metabolic pathways
ppsy01110  Biosynthesis of secondary metabolites
ppsy01120  Microbial metabolism in diverse environments
Module
ppsy_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AOC04_10415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppsy01007]
    AOC04_10415
Enzymes [BR:ppsy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     AOC04_10415
Amino acid related enzymes [BR:ppsy01007]
 Aminotransferase (transaminase)
  Class III
   AOC04_10415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ALE88582
UniProt: A0A0M5M1H8
Position
2352525..2353772
Genome map
AA seq 415 aa AA seqDB search
MPNLVGDVSSAARILPDLNGEKLFIRKGKGACLEDADGRRYIDTALGFGAVLLGHANDRV
NLAVSEALGDSAAPSWAHVREHGAATALASHTGELSKVIFTNSGSEAVHLACRAARAYTG
RGKIAKMAGGFDGWFDDVSYGNVSSTEAGFEDGQRPSTERTTLLRYNDFADVERLFAEDP
DIAAVVLEPMLANAGCIMALPGYLKHVQEIAHQHGALVICDEVLMGFRLYAGLAGVLEGL
DPDLASVGKAIGNGVPVSAVVGKPHILAGFEEGRVIRGGTFSGNPMACAAVTSTLAQLDT
ADYEALMARGNHLRQAIESLFKAHGVTITTSGYGNVFGIWLGATAPGTYEQAARAANPRF
TLALHLALREAGLLMMPSPYGRIYISFEHTDSVIEEMKNAFAQAAARLSAEFANA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatctagtgggtgatgtttccagtgcagcccgcatcctgcccgacctgaacggt
gaaaagctgtttattcgcaagggcaagggcgcctgtcttgaagatgctgatgggcgacgc
tacatcgataccgcgctgggcttcggcgcagtgctgctcggccatgccaatgaccgagta
aacctggcggtcagcgaagcgctgggcgacagtgccgccccttcctgggcccatgtacgt
gaacatggcgcggcaactgcgctggccagccataccggcgaactgtcaaaggtcatcttc
accaactccggcagcgaagcggtacacctggcctgccgcgccgcccgtgcttacaccggc
cgcggcaagattgccaagatggcgggcggtttcgacggctggtttgatgacgtcagctac
ggcaatgtcagctccaccgaagccggtttcgaagatggccagcgcccctcgaccgagcgc
acgaccctgctgcgctacaacgactttgccgatgtcgaacggctgtttgccgaagatccg
gacattgccgccgttgtgcttgaacccatgctggccaacgccggctgcatcatggcattg
cccggttacctcaagcatgtacaggagatcgcccaccaacacggcgccctggtgatttgt
gatgaggtgctgatgggctttcggctgtatgccggcctggcgggtgtgctcgagggtctg
gacccggacctcgccagtgtcggcaaggccatcggtaacggcgtgccggtctccgccgtg
gtcggcaagccgcacatcctggccggctttgaagagggccgggtgattcgtggcggcacc
ttcagcggaaaccccatggcctgcgcagccgtaaccagcaccctggcacaactggacact
gccgactatgaagcgctgatggcccgcggcaaccatttgcgccaagccatagaaagcctg
ttcaaggcccatggcgtgaccattaccaccagcggctacggcaatgtattcggaatctgg
ctcggtgccacggcgcccggcacttacgagcaggccgcccgggcagccaacccgcggttc
accctggctctgcatctggcattgcgtgaagccgggctgttgatgatgccgtcgccctat
gggcggatctacatcagcttcgaacacaccgacagcgtgatcgaagaaatgaagaacgcc
tttgcacaggcggctgcccggctaagcgcagaattcgccaatgcctga

DBGET integrated database retrieval system