KEGG   Pseudomonas versuta: AOC04_10780Help
Entry
AOC04_10780       CDS       T04081                                 

Definition
(GenBank) ketoglutarate semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00040  Pentose and glucuronate interconversions
ppsy00053  Ascorbate and aldarate metabolism
ppsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AOC04_10780
   00053 Ascorbate and aldarate metabolism
    AOC04_10780
Enzymes [BR:ppsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     AOC04_10780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALE88649
UniProt: A0A0M3UE55
Position
2464394..2465977
Genome map
AA seq 527 aa AA seqDB search
MSTVTGQNFIGGSRSAAGTVTLESLDASTGVALPFRFHQATPEEVDRAANAADQAFVEFR
QLSPERRAEFLDAIADEIDQLGDDFVALVCRETALPAGRIQGERGRTSGQMRLFAKVLRR
GDFLGARIDLAMPDRKPLPRVDLRQYRIGVGPVAVFGASNFPLAFSTAGGDTAAAFAAGC
PVVFKAHSGHMATADQVGCAIIRAAEKTGMPKGVFNMIFGAGVGEPLIKHPAIQAVGFTG
SLHGGNALSKMAAEREQPIPVFAEMSSINPVILLPQALAARGDKVAGELAASVTMGGGQF
CTNPGLVIGLRCPELSAFIEHLTQQMTEQAPHTLLNAGGLRNYTKGVEHLLGHKGITHLA
GHTQSGAQAQPQLFKADVSLLLNKDPLLQEEVFGPATIIIEVENDAQLKDALLALRGQLT
ATLIGEPGDLEHYQWLVPILEQKVGRILVNGYPTGVEVCDAMVHGGPYPATSDARGTSVG
SLAIDRFLRPVCYQNYPDALLPAALQNRNPLGLQRLVNGEWSSKAIA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccgtaacaggccaaaactttatcggcggcagccgtagcgctgccggcacagtc
acccttgaaagccttgatgccagcaccggcgttgccctgccttttcgctttcatcaggcc
acgcccgaggaagtagaccgcgccgccaacgccgccgatcaggcctttgtcgaattccgc
cagctgagccctgaacgccgcgccgaatttctcgatgccattgctgacgaaatcgaccaa
ctgggcgatgactttgtggcgttggtctgccgtgaaaccgcactgcccgccggacgtatc
cagggcgaacgcggccgtaccagcggccagatgcgcctgttcgccaaagtcctgcgtcgt
ggtgactttctgggggcccgtatcgacctggccatgccggaccgcaaaccgctgccacgg
gtggacttgcgtcagtaccgcatcggcgttggcccggttgccgtgttcggcgccagcaac
ttcccgctggccttctccactgccggtggcgacactgccgccgctttcgcagctggctgc
ccggtggtcttcaaggcccacagtggccacatggcaacggctgaccaggtgggttgcgcg
atcattcgcgccgcagaaaaaaccggcatgcccaagggcgtgttcaacatgatcttcggc
gctggcgtcggtgaaccgctgatcaaacacccggccattcaggccgtgggttttaccggc
tcactgcatggcggcaacgcgctgagcaaaatggctgccgaacgtgagcaacctatcccg
gtgtttgccgagatgtcgagcatcaacccggtgatcctgctgcctcaagcgctggccgca
cgcggtgacaaagtggcaggcgagctggccgcatcggtgaccatgggcggaggccagttc
tgcaccaaccccggcctggtgatcggtctgcgctgccccgagctttcggcttttatcgaa
cacctcacgcaacagatgaccgagcaagcgccgcacaccctgctcaatgcgggcgggttg
cgtaactacaccaagggcgtcgaacacctgctgggtcataaaggcatcactcacctggcc
ggccacacccagtccggcgctcaggcccagccgcaattgttcaaggccgatgtcagcctg
ctactgaacaaggatcctttgctgcaagaagaagtgttcggcccggcaacgatcatcatc
gaagtggaaaatgacgcccagctcaaggacgccctgctggccctgcgcggacaattgacc
gccaccctgattggcgaaccgggcgaccttgagcactaccagtggctggtgccgattctt
gagcaaaaagtgggtcgtattctggtcaatggctacccgaccggcgtcgaagtgtgcgat
gccatggttcacggcgggccttacccggccacttcggatgcacgcggcacctcggttggc
tcgctggccatcgaccggttcttgcgcccggtgtgctaccagaactatcccgatgcattg
ctgccggcagcgttgcaaaatcgcaacccgctgggcctgcaacgcctggttaatggcgag
tggagctccaaggcgattgcttaa

DBGET integrated database retrieval system