KEGG   Pseudomonas versuta: AOC04_12805Help
Entry
AOC04_12805       CDS       T04081                                 

Gene name
phhB
Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00790  Folate biosynthesis
ppsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AOC04_12805 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppsy04147]
    AOC04_12805 (phhB)
Enzymes [BR:ppsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     AOC04_12805 (phhB)
Exosome [BR:ppsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOC04_12805 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ALE89009
UniProt: A0A0M3UEC9
Position
2882651..2883007
Genome map
AA seq 118 aa AA seqDB search
MNTLNQAHCEACRADAPQVSDEELPILIKQIPDWNIEVRDGVMQLEKVFLFKNFKFALAF
TNAVGEIAEAEGHHPGLLTEWGKVTVTWWSHSIKGLHRNDFIMAARTDDVAKTAEGRK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaacacactgaaccaagcccactgcgaagcctgccgcgccgatgctccacaagtcagc
gatgaagagttgccgatcctgatcaaacagatcccggactggaatatcgaagttcgcgac
ggcgtcatgcaactggaaaaggtttttctgttcaagaacttcaaatttgccctggccttt
accaacgccgtgggtgaaatcgctgaagccgaaggtcatcacccgggcctgctcaccgag
tggggcaaagtgaccgtgacctggtggagccactcgatcaaaggcctgcaccgcaatgat
ttcatcatggccgcacgcactgacgacgtggcgaaaaccgctgagggccgcaagtaa

DBGET integrated database retrieval system