KEGG   Pseudomonas versuta: AOC04_16965Help
Entry
AOC04_16965       CDS       T04081                                 

Definition
(GenBank) 4-hyroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00360  Phenylalanine metabolism
ppsy00362  Benzoate degradation
ppsy00621  Dioxin degradation
ppsy00622  Xylene degradation
ppsy01100  Metabolic pathways
ppsy01120  Microbial metabolism in diverse environments
ppsy01220  Degradation of aromatic compounds
Module
ppsy_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AOC04_16965
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOC04_16965
   00622 Xylene degradation
    AOC04_16965
   00621 Dioxin degradation
    AOC04_16965
Enzymes [BR:ppsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     AOC04_16965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: ALE89773
UniProt: A0A0M4QRY0
Position
3774863..3775882
Genome map
AA seq 339 aa AA seqDB search
MTFNPGKKIYISDVTLRDGSHAVRHQYSLQNVQDIARALDKAKVDSIEIAHGDGLQGSSF
NYGFAAHTDLEWIEAAADVISHAKITTLLLPGIGTVHDLKAAYNAGARVVRIATHCTEAD
VSKQHIEYARELGMDTVGFLMMSHMIPAEQLAEQAKLMESYGATCVYMADSGGAMNMQDI
RDRFRAFKAVLKPQTETGMHAHHNLSLGVANSITAVEEGCDRIDASLAGMGAGAGNAPLE
VFIAAAERLGWNHGTDLYTLMDAADDIVRPLQDRPVRVDRETLALGYAGVYSSFLRHAEI
AATKYGLKTLDILVELGKRRMVGGQEDMIVDVALDLLKR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacctttaaccccggcaaaaaaatctacatcagcgacgtgaccctgcgcgatggcagc
cacgcggttcggcatcagtactcgctgcagaacgtgcaggacatcgcccgcgctctggac
aaggccaaggtcgattcgatcgaaatcgcccacggtgacggcctgcaaggttccagcttc
aactacggctttgccgcgcacactgatctggaatggatcgaagccgccgccgacgtgatc
agccacgccaaaatcaccaccttgctgctgcccggcatcggtacggttcatgacctcaaa
gccgcgtacaacgccggtgcccgggtggtgcgcatcgccacccattgcaccgaagcggat
gtctcgaaacaacacatcgagtacgcccgcgaactgggcatggacaccgtcggcttcctg
atgatgagccacatgatcccggccgaacagctggcagaacaggccaagctgatggaaagc
tacggcgcgacctgcgtgtacatggccgactccggtggcgcgatgaacatgcaggacatt
cgtgaccgttttcgcgcgttcaaagccgtgctcaagccgcagaccgaaaccggtatgcac
gcgcaccacaacctgagcctaggtgtggccaactcgatcaccgcggtcgaggaaggttgc
gaccgcatcgacgccagccttgccggcatgggcgccggggccggcaatgccccgctggaa
gtgttcatcgccgccgccgaacgcctgggctggaaccacggcaccgacctgtacacgctg
atggacgccgctgacgacatcgtgcgcccgttgcaggaccggccggtgcgggtcgaccgc
gaaaccctggcgctgggttatgccggggtttactcaagcttcctgcgccacgccgagatc
gccgctaccaagtacggcctcaagaccctcgacatcctcgtcgagctgggcaagcgccgg
atggtcggtggtcaggaagacatgatcgtcgatgtggcgctggacctgctcaaacgctga

DBGET integrated database retrieval system