KEGG   Pseudomonas versuta: AOC04_18405Help
Entry
AOC04_18405       CDS       T04081                                 

Gene name
putA
Definition
(GenBank) transcriptional regulator
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00250  Alanine, aspartate and glutamate metabolism
ppsy00330  Arginine and proline metabolism
ppsy01100  Metabolic pathways
ppsy01110  Biosynthesis of secondary metabolites
ppsy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOC04_18405 (putA)
   00330 Arginine and proline metabolism
    AOC04_18405 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppsy03000]
    AOC04_18405 (putA)
Enzymes [BR:ppsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     AOC04_18405 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     AOC04_18405 (putA)
Transcription factors [BR:ppsy03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    AOC04_18405 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: ALE90030
UniProt: A0A0M4QBU4
Position
4117305..4121258
Genome map
AA seq 1317 aa AA seqDB search
MATTTLGVKLDDPTRERLKAAATSIDRTPHWLIKQAIFNYLEKLEGGATLNELSGIPGIN
SDDADDVQTDHAHQCFLEFAESILPQSVLRAAITSAYRRPEPEVVPMLLEQARLPAPMAE
ATQTLAASIAEKLRNQKSAGGRAGIVQGLLQEFSLSSQEGVALMCLAEALLRIPDKGTRD
ALIRDKISTGNWHPHLGNSPSLFVNAATWGLLLTGKLVSTHNEAGLTSSLSRIIGKSGEP
MIRKGVDMAMRLMGEQFVTGETIAEALANATRFEAKGFRYSYDMLGEAALTAHDAQKYLA
SYEQAIHSIGKASNGRGIYEGPGISIKLSALHPRYSRAQYERVMDELYPILLSLTLLAKQ
YDIGLNIDAEEADRLELSLDLLERLCFEPQLSGWNGIGFVIQAYQKRCPYVIDYVIDLAR
RSRHRLMIRLVKGAYWDSEIKRAQVEGLEGYPVYTRKVYTDVSYIACAKKLLAVPEAIYP
QFATHNAHTLSAIYHLAGQNYYPGQYEFQCLHGMGEPLYEQVVGKVSEGKLNRPCRVYAP
VGTHETLLAYLVRRLLENGANTSFVNRIADHTISIHQLVADPVSQIEQMATAEGGFGLPH
PRIPLPRDLYGSERANSSGIDMANEHRLASLSCALLASAHNDWKAAPMLGCPSSNEVAAA
VLNPSDLRDVVGYVQEATVEDADNAIQCALSNAPIWQATPPAERAAILERAADLMEAEIQ
PLMGLLAREAGKTFANAIAEVREAVDFLRYYAVQARNDLTNDAHRPLGPVVCISPWNFPL
AIFSGQVAAALAAGNPVLAKPAEQTPLVAAQAVRILLEAGIPEGVLQLLPGRGETVGARL
VGDDRVKGVMFTGSTEVARLLQRNVAGRLDAQGRPIPLIAETGGQNAMIVDSSALTEQVV
IDVVSSAFDSAGQRCSALRVLCLQEDSADRVIEMLKGAMAESRMGNPERLNVDIGPVIDA
EAKAGIEQHIQGMRDKGRNVYQMAIADIEECKRGTFVMPTLIELESFDELEREIFGPVLH
VVRYKRKDIDQLIAQINASGYGLTLGVHTRIDETIAKVVNNVNAGNVYVNRNIVGAVVGV
QPFGGEGLSGTGPKAGGPLYLYRLLSTRPANAIEQSFAKVDAITAPDTQAREVMSKPLNA
LQAWATSNQQPALAELCGEYAAHSQSGITRLLNGPTGERNSYAILPREHVLCLAEVESDL
LTQLAAVLAVGSTAVLPESELAKALVARLPKEVKARITRVPDWTKDDVIFDAVVHHGDCD
QLRDVCQQVAKRPGAIIGVQGLSQGETNIALERLVIERALSVNTAAAGGNASLMTIG
NT seq 3954 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaccacccttggggtcaaacttgatgaccctacccgcgagcgcctcaaagcc
gccgcgacctcgattgatcgcacgccacactggctgatcaagcaggcaatcttcaattac
ctggaaaaactcgagggtggtgcaaccctgaatgagttgagcggtatccctggcattaac
agcgatgacgccgacgacgtacaaacggaccacgcgcatcagtgcttcctggagttcgca
gaaagcatcctgccgcaatccgtattgcgcgcagccattacttcagcctaccgccgcccg
gaaccggaagtggtgcccatgctgctggagcaggcccgtctgcccgcgccaatggcggaa
gccacacaaaccctggccgcctcgattgccgaaaaactgcgcaatcagaagagcgctggc
ggccgtgcaggtattgtccagggcctgctgcaagaattctccctgtcgtcccaggaaggc
gtggcactgatgtgcctggccgaagcgctgttgcgtatcccggacaaaggcacccgtgac
gccctgatccgcgacaagatcagcaccggcaactggcatccgcacctgggcaacagcccg
tcgctgttcgttaacgcggccacctggggcctgttgctgaccggcaagctggtgtcgacc
cacaacgaagcaggcctgacttcctccctgagccggattatcggcaaaagcggcgagccg
atgatccgcaagggcgtcgacatggccatgcgcctgatgggcgaacagtttgtaaccggc
gagaccatcgccgaagccctggccaacgccacgcgctttgaagccaaaggcttccgctat
tcctacgacatgctcggcgaagcggcactgaccgcccatgacgcgcagaagtacctcgcg
tcctacgagcaagccatccactcgatcggcaaagcctccaacggccgcggcatttacgaa
ggcccgggcatttcgatcaagctgtcggccctgcacccgcgctacagccgcgcccagtac
gaacgcgtcatggacgagctgtacccgatcctgctgtcgctgaccctgctggccaaacaa
tatgacatcggcctcaacatcgatgccgaagaagccgaccgccttgaactgtcgctcgac
ctgctcgagcgcctgtgcttcgagccacagctgagcggctggaacggtatcggttttgtg
atccaggcttaccagaagcgttgcccgtacgtgatcgactacgtaatcgacctggcacgc
cgcagccgtcaccgcctgatgatccgcctggttaaaggcgcgtactgggacagcgaaatc
aagcgcgcccaggtcgaaggcctggaaggctatccggtctacacccgcaaggtgtacacc
gacgtttcctacattgcttgcgcgaaaaaactgctggccgtacctgaagccatttacccg
cagttcgctacgcacaacgcccacaccctgtcggccatctaccacctcgccggtcagaac
tactacccgggccagtacgagttccagtgcctgcacggcatgggcgaaccactgtacgag
caagtcgtaggcaaggtttccgaaggcaagctgaatcgtccgtgccgcgtgtacgcaccg
gtcggcacccacgaaaccctgctggcgtacctggtacgtcgtctgctggaaaacggggcg
aacacttcgttcgttaaccgtatcgccgaccacacgatctcgatccaccagttggtggcc
gacccggtgagccagatcgagcagatggcgaccgcggaaggcggcttcggcctgccgcac
ccgcgtatcccgctgccgcgtgacctgtacggtagcgagcgcgccaactccagcggcatc
gacatggccaacgaacaccgtctggcctcgctgtcctgcgccctgctggcttcggcccat
aacgactggaaggccgcgccgatgctcggctgcccgtcgagcaacgaagtggctgcagca
gtcctcaacccgtccgacctgcgtgacgttgtcggctacgtacaggaagccacggttgaa
gatgccgacaacgccattcagtgcgccctgagcaacgccccgatctggcaggccaccccg
cccgccgagcgcgcagcgattctggaacgcgctgccgacctgatggaagccgaaatccag
ccactgatgggcctgctggcccgtgaagccggcaagaccttcgccaacgccattgccgaa
gttcgtgaagcggtcgacttcctgcgttactacgcagtacaggcacgcaacgacctgacc
aacgacgcccaccgcccactgggtccggtggtttgcatcagcccgtggaactttccgctg
gccatcttcagcggccaggtggctgcagcgctggctgccggtaacccggtactggccaag
cctgcggaacagaccccgctggtggcggcacaagcagtacgcattctgctggaagccggt
attcccgagggcgtgctgcaactgctgccgggccgtggcgaaactgtaggtgcacgcctg
gtcggcgacgatcgggtcaaaggggtgatgtttaccggttccaccgaagtcgcacggttg
ctgcaacgcaacgtggccggtcgtctggatgcccagggtcgcccaatcccgctgatcgct
gaaaccggcggccagaacgccatgatcgtcgactcctcggcgctgaccgagcaagtggtc
atcgacgtcgtgtcctcggccttcgacagtgccgggcaacgctgctcggccctgcgcgta
ctgtgcctgcaagaagattcggcagaccgcgtcatcgaaatgctcaaaggtgccatggcc
gaatcgcgcatgggcaaccctgaacgtctgaacgtggacattggcccggtgatcgacgcc
gaagccaaggccgggatcgagcaacacatccagggcatgcgtgacaaaggtcgcaatgtt
taccagatggccattgccgacatcgaagagtgcaaacgcggcaccttcgtgatgccgacc
ctgattgaactggaaagctttgacgagctggaacgcgaaatcttcggcccggtcctgcac
gtcgttcgctacaagcgcaaagacatcgaccagctgatcgcacagatcaacgcttcgggt
tacggcctgacgctgggcgtgcacacccgtatcgacgaaaccatcgccaaggtggtcaac
aacgtcaatgccggcaacgtctacgtcaaccgcaacatcgtaggcgcagtggtcggcgtg
caaccgtttggcggcgaaggcctgtcaggcaccggccctaaagccggtggcccgctgtac
ctgtaccgcctgctgtcgacccgcccggccaacgcgatcgagcaatcattcgccaaagtc
gacgccatcaccgctccggacacccaggcccgcgaagtaatgagcaaaccgctcaacgcc
ctgcaagcctgggccaccagcaaccagcaacctgcgctggcagagctgtgcggcgagtac
gcagcacattcgcaaagcggcatcacccgcctgctgaacggcccgactggcgaacgcaac
agctacgccatcctgccgcgcgagcacgtgctgtgcctggccgaagttgaaagcgacctg
ctgacccagctggctgcggtcttggccgtaggcagcacggcagtcctgccggaaagcgaa
ctggccaaagcactggttgcacgcctgccaaaagaagtgaaggcgcgcattactcgggtg
ccagactggaccaaggacgacgtcatcttcgacgccgttgtccatcacggcgactgcgat
caacttcgtgacgtctgccagcaagtggcaaaacgtccgggcgccattatcggcgtacag
ggcctgtcccagggcgagaccaacatcgccctggaacgcctggtgatcgagcgcgcactg
agcgtcaacaccgcggcagctggtggtaacgcaagtttgatgacgatcggctga

DBGET integrated database retrieval system