KEGG   Pseudomonas versuta: AOC04_22055Help
Entry
AOC04_22055       CDS       T04081                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ppsy  Pseudomonas versuta
Pathway
ppsy00260  Glycine, serine and threonine metabolism
ppsy01100  Metabolic pathways
ppsy01110  Biosynthesis of secondary metabolites
ppsy01120  Microbial metabolism in diverse environments
ppsy01130  Biosynthesis of antibiotics
ppsy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppsy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AOC04_22055
Enzymes [BR:ppsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AOC04_22055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ALE90720
UniProt: A0A0M5LZ95
Position
complement(4917622..4918665)
Genome map
AA seq 347 aa AA seqDB search
MTDKSQQFASDNYSGICPEVWAAMELANHGHQRSYGDDEWTLRAANDFRKLFETDCEVYF
AFNGTAANSLALSSLCQSFHSVICSETAHVETDECGAPEFFSNGSKLLIARTENGKITPE
SIREIALKRKDIHYPKPRVVTITQATEVGSVYRPEEIRAINATCKELGLLLHMDGARFSN
ACAYLGCSPAELSWKAGVDVLCFGGTKNGMAVGEAILFFDHALAVDFDYRCKQAGQLASK
MRFLSAPWVGLLENDAWLKHSRHANHCAQLLSQLVSDIPGVELMFPVEANGVFLQLSEPA
VAALTAKGWRFYTFIGKGGARFMCSWDTEEARVRELAADIREVMGTN
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaagagccaacaattcgccagcgacaactactccggtatctgtcccgaagtc
tgggccgccatggagctggccaaccacggccaccagcgctcatatggtgatgacgaatgg
accctgcgggccgccaacgatttccgcaaattgttcgaaaccgattgcgaggtgtacttc
gccttcaacggcaccgccgccaactcactggccctgtcgtcgttgtgccagagcttccac
agcgtgatctgctccgagaccgcccacgtcgaaaccgacgaatgcggtgcgccggagttc
ttctccaacggctcgaaactgctgattgcccgcactgaaaacggcaagatcacccccgag
tcgatccgcgaaatcgccctcaagcgcaaagacatccactaccccaagccgcgggtcgtc
accatcacccaggccaccgaagtcggcagcgtgtaccgcccggaagaaatccgcgccatc
aacgctacctgcaaggagctgggcctgctgttgcacatggacggcgcccgtttttccaat
gcttgcgcgtacctggggtgctcgcctgcggagctgagctggaaagccggggttgatgtg
ctgtgctttggcgggaccaaaaacggcatggcggtgggcgaagcgattctgttctttgat
cacgccctggccgtggattttgactatcgctgcaaacaggccgggcaactggcgtcgaaa
atgcgttttctgtcagcaccctgggtcggcttgctggaaaacgacgcctggctcaaacat
tcccgccacgccaaccactgcgcacaattgctgagccagctggtcagtgacattccgggg
gttgagctgatgtttccggtggaagccaacggcgtgttcctgcaactgtcggaaccggct
gtggcagcgctgacagccaagggctggcgcttttacacctttatcggcaagggcggcgca
cgcttcatgtgctcatgggataccgaagaggcgcgggtgcgggaactggcagcggatatc
cgcgaagtgatgggtacaaattaa

DBGET integrated database retrieval system