KEGG   Pseudomonas putida S16: PPS_0045Help
Entry
PPS_0045          CDS       T01570                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00260  Glycine, serine and threonine metabolism
ppt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01130  Biosynthesis of antibiotics
ppt01230  Biosynthesis of amino acids
Module
ppt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPS_0045
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPS_0045
Enzymes [BR:ppt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PPS_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEJ10634
UniProt: F8FU84
Position
complement(48590..49807)
Genome map
AA seq 405 aa AA seqDB search
MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKADPKFLEELAYFQRDYI
GRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTGTLKDAMNE
ALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKEGRLPDSLVACVG
GGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHAASLNGGIPGVLHGNRTYLLQDEDG
QITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEALDAFHATCRLEGIIPALESS
HALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQTVMNHMAAQEKQA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcccaataccgccccggccccgacgccaatggcctgttcggctcgttcggc
ggccgctacgtggccgaaaccctgatgccactggtgctggacctggcccgcgaatacgaa
gcggccaaggcagaccccaagttcctcgaagagctggcctacttccagcgcgactacatc
gggcgccccaacccgctgtacttcgccgagcgcctgaccgagcactgcggcggcgccaag
atcttcttcaagcgtgaagagctcaaccacaccggcgcgcacaaggtgaacaactgcatc
ggccaggtgctgctggccaagcgcatgggcaagaagcgcctcatcgcagaaaccggcgcc
ggcatgcacggcgtggccaccgccaccgtcgctgcccgcttcggcctgccttgcgtaatc
tacatgggcgccaccgacatcgagcgccagcaggccaacgtgttccgcatgaagctgctt
ggcgccgaaatcgtcccggtcactgccggcaccggcaccctgaaggacgccatgaacgag
gctctgcgcgactgggtcaccaacgtcgaagacaccttctacctgatcggcaccgtggct
ggcccgcacccgtatccggccatggtccgcgacttccagtcgatcatcggcaaggaaacc
cgcgcccagttgcaagagaaggaaggccgcctgccagacagcctggttgcctgcgtcggt
ggtggctccaacgccatgggcctgttccatgagtttctcgaagagccaagcgtgcagatc
atcggcgtcgaagccggtggccacggcgtgcacaccgacaagcacgccgccagcctgaac
ggcggcataccgggcgtgctgcacggcaaccgcacctacctgctgcaggacgaagacggt
cagatcaccgacgcccactcgatttccgccggcctggactacccgggcatcggcccggag
cacgcctacctgcacgaagtgaagcgtgtcgagtacgtcagcatcaccgacgacgaagcg
ctggatgcattccatgccacctgccgcctggaaggcatcatcccggccctggaaagctcc
cacgccttggccgaggcgatcaagcgcgcaccgaagctgcccaaggaccacctgatggtc
gtgtgcctgtcgggccgcggcgacaaagacatgcaaaccgtcatgaaccacatggccgcc
caggagaaacaggcatga

DBGET integrated database retrieval system