KEGG   Pseudomonas putida S16: PPS_0380
Entry
PPS_0380          CDS       T01570                                 

Definition
(GenBank) 6-hydroxy-3-succinoylpyridine hydroxylase
  KO
K15359  6-hydroxy-3-succinoylpyridine 3-monooxygenase [EC:1.14.13.163]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00760  Nicotinate and nicotinamide metabolism
ppt01100  Metabolic pathways
ppt01120  Microbial metabolism in diverse environments
Module
ppt_M00811  Nicotine degradation, pyrrolidine pathway, nicotine => succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PPS_0380
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.163  6-hydroxy-3-succinoylpyridine 3-monooxygenase
     PPS_0380
SSDB
Motif
Pfam: DUF2384 NYN
Other DBs
NCBI-ProteinID: AEJ10965
UniProt: F8FZQ5
Position
449898..450845
AA seq 315 aa
MQKMQRKLDSEPLRTRIYIDGYNFYYGCLRGTPYKWLDLLPLFEKHILPSILVTDNHGQI
RAWRLLESPSIKYFTAKIIESVARAGDSVSSQARYHTALRKLHDGRIELIEGYYAVNKMK
VKIVDPENPDKAPRECREIQAWKVEEKQSDVNLALQAYHDSITGQVDHAVIVTNDTDIAP
ALQMIRAHTDVRIGVVVPTSGQNRSANTDLIKFAHWKREHINSGELAACQLPRVIPGRKP
TIKPESWYGQPELLQEILDLAIPVRGSRAAAFKWMEQPNQFLSGERPIELVETAEGATRV
LQYIHSWIAQQEELP
NT seq 948 nt   +upstreamnt  +downstreamnt
gtgcaaaaaatgcagagaaagcttgattctgagcctctgcgcactcgtatctatatcgac
ggctacaacttctactacggctgcttgcgcggcacaccgtacaagtggctcgacctgttg
cctctctttgaaaagcacatcttgccttccatactggtcacggacaaccatggccagatc
agggcatggcggctcctggaatccccctcgatcaaatatttcacggcaaagatcatcgag
tcggtcgcccgtgctggcgattcggtgtcgtcacaagctcgctaccacaccgctttgcgc
aagctgcatgatggtcgaatagagctcatcgaaggttattacgccgtcaataaaatgaag
gtgaagatcgtcgaccctgaaaatccggacaaggctccgcgtgagtgccgggaaatccag
gcctggaaggtggaggagaaacagagcgacgtgaatctggccctccaggcttaccatgat
tcgatcacggggcaggttgaccatgccgtcatcgttaccaacgatactgacatcgctcct
gcacttcagatgattcgtgctcacacagatgtgcggattggcgtggttgtgccgacgtcg
gggcaaaaccgctcggcgaataccgacctgatcaagtttgcgcactggaagcgagagcac
atcaattcaggcgagcttgcggcctgtcagctaccgagagtgattccagggaggaaacca
accatcaagccggagtcctggtatgggcaacctgaactgctgcaggaaattctggatttg
gccattcctgtacgcggaagcagggcggcagcgttcaagtggatggagcagcccaatcag
ttcctcagtggtgagcggccgatagagctggtggaaactgccgaaggtgcgacacgggtt
cttcagtacatacacagctggatagcccagcaagaggagttgccctag

DBGET integrated database retrieval system