KEGG   Pseudomonas putida S16: PPS_0581Help
Entry
PPS_0581          CDS       T01570                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00071  Fatty acid degradation
ppt00072  Synthesis and degradation of ketone bodies
ppt00280  Valine, leucine and isoleucine degradation
ppt00310  Lysine degradation
ppt00362  Benzoate degradation
ppt00380  Tryptophan metabolism
ppt00620  Pyruvate metabolism
ppt00630  Glyoxylate and dicarboxylate metabolism
ppt00640  Propanoate metabolism
ppt00650  Butanoate metabolism
ppt00900  Terpenoid backbone biosynthesis
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01130  Biosynthesis of antibiotics
ppt01200  Carbon metabolism
ppt01212  Fatty acid metabolism
ppt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPS_0581
   00630 Glyoxylate and dicarboxylate metabolism
    PPS_0581
   00640 Propanoate metabolism
    PPS_0581
   00650 Butanoate metabolism
    PPS_0581
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PPS_0581
   00072 Synthesis and degradation of ketone bodies
    PPS_0581
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PPS_0581
   00310 Lysine degradation
    PPS_0581
   00380 Tryptophan metabolism
    PPS_0581
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PPS_0581
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PPS_0581
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PPS_0581
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppt04147]
    PPS_0581
Enzymes [BR:ppt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PPS_0581
Exosome [BR:ppt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPS_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEJ11166
UniProt: F8G3E4
Position
665851..667128
Genome map
AA seq 425 aa AA seqDB search
MRSLRRVAILGGNRIPFARSNGAYATASNQAMLTVALEGLIERYRLHGLRMGEVVAGAVL
KHSRDMNLTRECVLGSRLSPLTPAYDIQQACGTGLEAALLVANKIALGQIDCGIAGGVDT
TSDAPIAVNEGLRHILLQANRGKSLGERLKPFLKLRPHHLKPELPRNGEPRTGLSMGEHC
ERMAQAWRIGRAEQDELALLSHQALAAAYAEGWQDDLLTPFLSLTRDNNLRPDLTLEQLA
KLKPAFDRSGQGTLTAGNSTPLTDGASLVLLGSEEWAEQQGLSVLAYLVDGETAAVDFVT
GREGLLMAPMYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWEDADYCRERLGLD
APLGAIDRSKLNVKGSSLAAGHPFAATGGRILANLAKLLARSGKGRGLISICAAGGQGVT
VIVER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcacttcgccgggtcgcgatcctgggcggcaaccgaattcccttcgcccgttcc
aatggcgcctacgccacggccagcaaccaggcgatgctaaccgtcgccctcgaagggctg
atcgaacgctaccgcctgcatgggttgcgcatgggggaggtggtggctggcgctgtgctc
aagcactcgcgagacatgaacctgacacgtgagtgcgtgctgggttcgcgcctgtcgccg
ctgacgccagcctatgacatccagcaagcctgcgggacggggctagaggcggcactgctg
gtggccaacaagattgccctggggcagatcgactgcggcatagccggcggtgtggacacc
acctccgatgcgccgattgcggtcaacgaaggcctgcgccacatcctgttgcaggccaac
cgtggcaagagcctgggcgaacggctcaagccatttctcaagctgcgtcctcaccacctg
aaacccgaattaccgcgcaacggtgagccgcgcaccggtttgtctatgggcgagcattgc
gaacgcatggcccaggcctggcgcattggccgtgccgagcaggacgagctggcgctgctg
agccaccaggcgctggctgccgcgtacgccgaagggtggcaggatgacctgctgacgccg
tttctgtctttgacccgtgataacaacctgcgccccgacctgacgctggaacaattggcc
aagctcaagccagccttcgaccgcagcgggcagggcacgctgacggcgggcaactccaca
ccgctgaccgatggtgcttcgctggttttgctgggcagcgaggaatgggccgagcagcag
gggctgtcggtgctggcctatctggtcgatggtgaaaccgctgcggtggatttcgttact
ggtcgcgaagggctgttgatggcgccgatgtatgcggtgccgcggctgttggcgcgcaat
ggcctgacgctgcaggactttgactattacgagattcacgaagcctttgctgcccaggtg
ctgtgcacgctcaaggcctgggaagatgccgattattgccgcgaacggctggggctggat
gcgccgctcggggcgattgaccgcagcaagctcaacgtcaagggcagttcgctggcggcc
gggcacccgtttgccgcgaccggggggcggatattggccaacctggccaagctgctggcg
aggtcggggaaggggcgggggttgatatcgatctgcgctgcgggtgggcagggggtgacc
gtcatcgtcgagcgctga

DBGET integrated database retrieval system