KEGG   Pseudomonas putida S16: PPS_1331Help
Entry
PPS_1331          CDS       T01570                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00860  Porphyrin and chlorophyll metabolism
ppt01100  Metabolic pathways
Module
ppt_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPS_1331
Enzymes [BR:ppt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     PPS_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEJ11906
UniProt: F8G2K5
Position
1460912..1461478
Genome map
AA seq 188 aa AA seqDB search
MILDLLRHGETEQGGLRGSLDDALTDKGWAQMRQAVAEAGPWEVLVSSPLQRCACFAEEL
GERLNLPVQREAALQELHFGDWEGRSAAQIMEDQADALGRFWADPYAFTPPNGEPVEAFA
ERVLAAVERLSQQHAGKRVLLVTHGGVMRLLLARARGLPRAQLLQVEVGHAALMRLVPGD
DGQWVEGR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgacctgctgcgccatggcgaaacggaacagggcggcctgcgtggcagcctt
gatgatgccttgaccgacaagggctgggcgcagatgcgtcaagccgtggccgaagccggc
ccgtgggaggtgctggtcagttcgccgctgcagcgctgtgcgtgttttgccgaggaactg
ggcgagcggctgaacctgcctgtgcagcgcgaagcggcattgcaggagctgcattttggc
gactgggagggccgtagtgcggcgcagatcatggaagaccaggcggacgcgctggggcgc
ttctgggcggacccttacgcgtttacaccgcccaatggcgagccggtcgaggcgttcgcc
gagcgtgtgctggcggctgtcgagcgcctgagccagcagcatgctggcaagcgtgtgctg
ctggtcacccatggcggcgtgatgcggctgctgctggcccgtgcccgtggtttgccaagg
gcgcagttgctgcaggtcgaagtcggccacgctgcgctcatgcgattggtgccgggtgac
gacggccagtgggtcgaggggcgctga

DBGET integrated database retrieval system