KEGG   Pseudomonas putida S16: PPS_1417Help
Entry
PPS_1417          CDS       T01570                                 

Definition
(GenBank) mannose-6-phosphate isomerase/mannose-1-phosphate guanylyltransferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00051  Fructose and mannose metabolism
ppt00520  Amino sugar and nucleotide sugar metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01130  Biosynthesis of antibiotics
ppt02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PPS_1417
   00520 Amino sugar and nucleotide sugar metabolism
    PPS_1417
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PPS_1417
Enzymes [BR:ppt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     PPS_1417
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     PPS_1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase NTP_transf_3 Cupin_2 DUF2755
Motif
Other DBs
NCBI-ProteinID: AEJ11992
UniProt: F8G3Q3
Position
1563131..1564573
Genome map
AA seq 480 aa AA seqDB search
MELIPVILSGGVGSRLWPVSREAHPKPFMNLPDGQNLIQKTFLRAADLNGVVEILTVTNR
ELLFKTEDEYRTINKHNLNQGYILEPFGRNTAAAVAAAALQLLQSHGPQAHMLVLAADHL
IQNEAAFSEAVTQAVQLAEQGWLVTFGIKPQYPETGFGYIEAAAGGVLEGGLKVERFVEK
PDAKTAESYVAAGNYFWNAGMFCFQVGAVIEEFKAHAPDVLEAVERTLEASRRSTSKGYS
CLALDAESFANVPDISIDYALMERSRKVATIPCDIGWSDIGSWNAVSELTPPDASGNRFE
GEVMAHGARNNYVSTEDRLAALVGVQDLLVVDTPDALLIAHKDHAQDVKHIVKRLKSDGH
AAHLLHRTVHRPWGTYTTLEDGDRFKIKRIVVKPKASLSLQMHHHRSEHWIVVSGMAVVV
NDDQELMLNTNESTFIRAGHKHRLQNPGVIDLVLIEVQSGDYLGEDDIVRFEDNYGRCDA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaattgatcccggtaattttatccggtggcgttggtagccgtctgtggcctgtgtcg
cgtgaggctcatcccaagccgttcatgaacctgccagacgggcagaacctcatccagaaa
accttcctgcgcgccgccgatctgaatggtgtggttgaaatcctcacggtgaccaaccgc
gagctgctgttcaagactgaggacgaatatcgcacgatcaacaagcacaacctcaaccag
ggttacatccttgagccattcggccgcaatactgccgccgccgtggccgctgcggcgctg
caactgctacagtcccatggccctcaggcacatatgctcgtgctggcagccgaccacctg
atccagaacgaagcggccttctccgaagcggtgacccaggccgttcagttggccgagcag
ggctggctggtcacttttggcatcaagccccagtaccctgaaaccggcttcggatatatc
gaagcggcagctggcggtgtgcttgaaggtgggctaaaggtcgagcgcttcgtcgaaaaa
cctgatgctaaaactgccgagtcctatgttgccgctggcaactatttctggaacgccggc
atgttctgcttccaggttggcgcagtgatcgaagagttcaaggctcatgcgcccgatgtg
ctcgaagctgtcgaacgtacgcttgaagcctcgcgccgatccacctccaaaggttatagc
tgcctggccctggatgccgagagcttcgccaacgtgccggacatctctatcgactacgcc
ttgatggagcgctcacgcaaagtggcgaccattccatgcgatatcggttggagcgatatt
ggctcgtggaatgcggtcagtgaactgaccccgccggacgcgtctggtaaccgctttgaa
ggcgaagtgatggcccacggggcacgtaacaactatgtaagcaccgaggaccgcctggct
gcactggtaggcgtgcaggacttgctggtagtggataccccagatgcattgctcattgcc
cacaaagatcatgctcaggacgtcaagcatatcgtcaagcgcttgaagagcgatggccat
gccgcccacctgctgcaccggaccgtgcaccgtccatggggtacatacaccacgctggaa
gacggagaccgcttcaagatcaagcgcattgtggtcaagcccaaggcatcgctgtcactg
cagatgcaccaccaccgtagtgagcactggattgtggtcagcggtatggcagtggtggtc
aatgacgaccaagagttgatgctcaacaccaatgaatccacgttcattcgtgcgggccac
aagcaccgtttgcagaacccaggtgtaatcgacctggtgttgatcgaagttcaaagtggc
gactacctcggcgaagacgatatcgtccgcttcgaggacaactacggtcgttgcgacgcc
tga

DBGET integrated database retrieval system