KEGG   Pseudomonas putida S16: PPS_1825Help
Entry
PPS_1825          CDS       T01570                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00010  Glycolysis / Gluconeogenesis
ppt00620  Pyruvate metabolism
ppt00640  Propanoate metabolism
ppt00680  Methane metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01130  Biosynthesis of antibiotics
ppt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPS_1825
   00620 Pyruvate metabolism
    PPS_1825
   00640 Propanoate metabolism
    PPS_1825
  Energy metabolism
   00680 Methane metabolism
    PPS_1825
Enzymes [BR:ppt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PPS_1825
Lipid biosynthesis proteins [BR:ppt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PPS_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEJ12394
UniProt: F8FW60
Position
2043115..2044761
Genome map
AA seq 548 aa AA seqDB search
MRDYTEAARAFDHGQAAAAALHGNLEALNACVECCDRHAGEGKTALVWEDREGNSVRLSF
DQLQALAARFANVLEAQGVGAGDRVAGLMPRTPELLVTILATWRLGAVYQPLFTAFGPKA
IEHRLEQSHARVVVTDSHNRAKLDDVHACPTIITVNARNGELDFQQCLDKAADKCEPVMR
SGNDPFLLMFTSGTTGPAKPLEVPLRAIVAFQGYMRDAIDLRPEDNFWNLADPGWAYGLY
YAVTGPLSLGHATTFYDGPFSVESCARVIDKLGITNLAGSPTAYRLLIAAGDDFSAPIKG
RLRVVSSAGEPLNPEVIRWFADELGVTIHDHYGQTELGMVLCNHHGLQHPVHLGSAGFAI
PGHRIVVLDEQGNELPAGQPGILAVDREQSPLCWFAGYHGLPTKAFVGKYYLSGDTVELN
QDGSISFVGRSDDVITTSGYRVGPFDVESALIEHPAVIEAAVIGKPDPERTELIKAFVVL
ASGYQGSAELEEALRQHVRQRLYAHAYPREIEFVSELPKTPSGKLQRFILRNQEVAKQQA
QQATPASA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgattacaccgaggccgctcgtgcgttcgaccatggccaggctgctgcggcggcg
ctgcatggcaacctcgaagccctcaatgcctgtgtcgaatgttgcgaccgccatgccggt
gagggcaagaccgcactggtctgggaagaccgcgagggcaacagcgtgcgcttgagcttc
gaccagttgcaggcactggcggcccgtttcgccaatgtgctcgaagcgcaaggcgtgggt
gcgggtgaccgggtcgccggcctgatgccgcgtacccccgagctgctggtcaccatcctc
gccacctggcgtctcggcgcggtgtaccagccactgttcaccgcgttcggccccaaggcc
atcgaacatcgcctggagcagtcccacgcccgcgtggtcgtcaccgacagccacaaccgc
gccaagctggacgatgtgcacgcctgcccgaccatcatcaccgtcaatgcccgcaatggc
gagctggacttccagcagtgcctggacaaagccgcagacaaatgcgagccggtcatgcgc
tcgggcaacgacccgttcctgctgatgttcacctccggcaccaccggcccggctaaaccg
ctggaagtgccgctgcgtgccatcgtcgcgttccagggctacatgcgcgatgccatcgac
ctgcgccccgaggacaacttctggaacctggccgacccgggctgggcctatggcctgtat
tatgcggtcactggcccgctgtcgctgggccatgccaccaccttctacgatggcccgttc
agtgttgaaagctgcgcacgggtgatcgacaagctgggcatcaccaacctggccggctcg
cccaccgcgtaccgcctgctgattgccgccggggatgacttctcggcaccgatcaagggc
cgcctgcgggtggtcagcagtgccggtgaaccgctcaacccggaagtgatccgctggttc
gccgacgaactgggcgtgaccatccacgaccactacgggcagaccgaactgggcatggtg
ctgtgcaaccaccatggcctgcagcacccggtacacctcggctcggccggcttcgccatc
cccggccaccgcatcgtggtgctggacgagcagggcaacgaactgcctgccgggcagccg
ggcatcctcgcggtcgaccgcgagcagtcgccgctgtgctggttcgcgggctaccacggc
ctgccgaccaaagccttcgtcggcaagtactacctcagtggcgacaccgtcgaactgaac
caggacggcagcatcagcttcgtcggccgcagcgacgatgtgatcaccacctccggctac
cgggtcggcccgttcgacgtcgagagtgcactgatcgagcacccagcggtgatcgaagcg
gcggtgatcggcaaaccggacccggagcgcaccgaactgatcaaggccttcgtggtattg
gccagcggttaccagggcagcgccgagcttgaagaggctttgcgccagcacgtgcgccag
cgcctgtacgcccatgcctacccaagggaaatcgaattcgtcagcgagctgcccaagacc
ccgagcggcaagctgcaacgcttcatcctgcgcaaccaggaagtcgccaaacaacaagcg
caacaggccacccctgccagcgcctga

DBGET integrated database retrieval system