KEGG   Pseudomonas putida S16: PPS_2305Help
Entry
PPS_2305          CDS       T01570                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00625  Chloroalkane and chloroalkene degradation
ppt00680  Methane metabolism
ppt01100  Metabolic pathways
ppt01120  Microbial metabolism in diverse environments
ppt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    PPS_2305
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PPS_2305
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     PPS_2305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD PALP FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEJ12866
UniProt: F8G407
Structure
PDB: 

Position
2588140..2589315
Genome map
AA seq 391 aa AA seqDB search
MVYLGAGKVEVQHIDYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTAQVGLVL
GHEITGEVIEKGRDVEHLQIGDLVSVPFNVACGRCRSCKEMHTGVCLTVNPARAGGAYGY
VDMGDWTGGQAEYVLVPYADFNLLKLPNRDKAMEKIRDLTCLSDILPTGYHGAVTAGVGP
GSTVYVAGAGPVGLAAAASARLLGAACVIVGDLNPARLAHAKAQGFEVVDLSKDTPLHEQ
IIDILGEPEVDCAVDAVGFEARGHGHEGAKQEAPATVLNSLMQVTRVAGKIGIPGLYVTE
DPGAHDAAAKIGALSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRINIAEIVGVQ
VISLDQAPNGYGEFDAGVPKKFVIDPHRTFS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggtgtacctgggtgcaggtaaggtcgaggtgcaacacattgactacccgaaaatgcag
gacccgcgcggcaagaaaatcgagcacggggtgatcctcaaggtggtctccaccaatatt
tgcggctctgaccaacacatggtccgtggtcgcaccactgctcaggtgggcctggtactg
ggccacgagatcaccggtgaagtcatcgagaaggggcgggatgtcgagcatctgcagatc
ggcgatctggtgtcagtccccttcaacgtcgcctgtggtcgctgccggtcctgcaaagaa
atgcacacgggtgtctgccttacagtcaacccggctcgcgccggcggggcctatggctat
gtcgacatgggtgactggacaggtggtcaggccgaatacgtcctggtcccgtatgcagat
ttcaacctgctgaagttgccgaatcgcgacaaagccatggagaaaatccgggacttgacg
tgcttgtccgacattctaccaaccggctatcacggggcagttacggctggtgttggccct
ggcagcactgtttacgtcgccggtgccggccccgttggcctggctgccgctgcttctgca
cgtctgctgggcgcagcctgtgtgatcgtgggtgacctgaacccagctcgcctggctcac
gccaaggcgcaaggcttcgaagtggttgacctgtccaaagacaccccgttgcatgagcag
atcatcgacatcttgggcgaaccagaagtcgattgcgcggtggacgctgttggtttcgag
gcgcgtggccatggccatgaaggcgccaagcaggaggccccggccaccgtgctcaattcg
ttgatgcaagtgacccgtgttgccgggaaaatcggcatcccaggcctttatgtgactgaa
gacccgggcgcccatgatgctgccgccaagatcggtgcgctgagcatccgcttcggtttg
ggctgggccaagtcgcacagtttccacacgggccagacacctgtgatgaagtacaaccgt
cagttgatgcaggccatcatgtgggaccgcatcaacattgctgaaatcgtgggtgtacag
gtgatcagcctggaccaggcgcctaatggctacggtgaattcgatgcaggcgtaccgaag
aaattcgtgatcgatccacaccgcaccttctcctga

DBGET integrated database retrieval system