KEGG   Pseudomonas putida S16: PPS_2341
Entry
PPS_2341          CDS       T01570                                 
Name
(GenBank) type IV secretory pathway VirB4 components-like protein
Organism
ppt  Pseudomonas putida S16
SSDB
Motif
Pfam: TraC_F_IV FtsK_SpoIIIE AAA_22 DUF87 AAA_29 T2SSE AIG1 AAA_10
Other DBs
NCBI-ProteinID: AEJ12902
UniProt: F8G4S7
Position
complement(2634767..2637508)
AA seq 913 aa
MDEDADRTSQRWQPWRAAQRRRATRADEATQYAHNPSFTDHLPWVEYLEEEQCFLLDDNR
SVGAVFELQPIGTEGREPEWLMAARDALEDALQDSLDELDQAPWVVQFFCQDDSDFSPYL
ERLEQYVAPRATGTPFTAAFLTSMQHHLDAIAKPGGLFDDHVVSHLPWRGSNRRIRLVVY
RWLGDQADDEGQNPAQLLGRTCDRLMASLQACGVNPRRLTGQDFYAWLLPWFNPAPTLTG
ESPAAFYRRVPYPEIDDGDGLSLPFDHDFAERLFFQEPRSDSEQGLWYFDQQPHAVMVVD
KLRRPPHIGQLTGETRKGEALNALFDQLPEQAVLSLTLVITPQDVLEEQLNRLARKAIGE
NLASTQTRQDVEEARALIGRQHKLYRGTLALYLRGADEPQLRQRSIQAANVLLGAGLQPV
REGDEVAACNSYLRWLPMVYNPARDKRNWYTRLLFAQHVANLLPLWGRSIGTGNPGITFF
NRGGAPLSFDPLSRFDRSMNGHLLLFGPTGAGKSATLVSILMQVMAVYRPRLFIVEAGNS
FGLQGDYFATLGLTVNKVQLKPGSGLSLAPFADARRLIERPDQVASLSTEDLDEDASGSD
EQRDVLGELEITARLMITGGEVKEEARLTRADRSLIRECILDAARHCAASDQQVMTRHVR
DALRVVASDAHLPDKRRERAQEMAESIDLFCQGFEGALFDRPGTPWPESDVTIVDLATYA
REGYEAQMSISYISLMNTVNNLAERDQYLGRPIIMVTDEGHIITKNPLLAPFVVKGTKMW
RKLGAWFWLATQNLADFPDAAQTMLNMIEWWICLNMPPAEIEEIARFKKLTPAQKTLLLS
ASKASGKYTEGVVLSKQLETLFRAVPPSLYLTLAMTEPEEKAQRWRLMEAHQLSELEAAL
RIAADIDRLRGMS
NT seq 2742 nt   +upstreamnt  +downstreamnt
atggacgaggatgcagatcgcacatcgcagcgctggcagccctggcgcgccgcgcagcgt
cggcgcgcaacgcgtgcggacgaagctacgcagtatgcgcacaaccccagctttaccgac
cacttaccctgggtcgaatacctcgaggaggagcagtgctttctactcgacgacaaccgc
tcggtgggcgccgtgttcgagttgcagccgatcggcaccgagggccgtgagcccgaatgg
ctaatggcggcgcgcgatgcgttggaggatgcgctgcaggacagcttagacgagctcgac
caggcgccttgggtggtgcaattcttctgtcaggacgacagtgatttttccccgtacctg
gagcgcctggaacagtacgttgcaccacgggcgacaggtacccccttcactgcagctttc
ctcacctcgatgcaacaccacctcgatgccattgccaagccaggcggcttgttcgacgac
catgtcgtgtcgcacctgccctggcgcggcagcaatcgacggattcggctggtggtctat
cgctggctcggtgaccaggccgacgacgaagggcaaaaccccgctcaattgctgggaagg
acctgtgaccgcctgatggcctcgttgcaggcctgcggcgtcaatcctcggcggctgacg
gggcaggatttctatgcctggttgctgccgtggttcaatccggccccgactctcaccggt
gaatcaccagcggcgttctatcgacgcgtgccctacccggagatcgatgacggcgatggg
ctgtcgctaccgttcgaccacgactttgccgagcgactgttctttcaggagccacgctcg
gacagcgagcaggggctctggtatttcgatcaacagccgcacgcggtgatggtggtcgac
aaactgcgcaggccaccccacatcggccagctgaccggcgagacccgcaagggtgaagcg
ctcaacgctctgtttgaccagttacccgagcaggccgtcctgagcttgaccttggtcatc
acacctcaggatgtgctcgaggagcaactcaaccgcttggcgcgcaaagccatcggcgaa
aacctggcctcgacccagacccgccaggacgtggaagaggcccgcgcgctgattggccgc
cagcacaagctataccgcggcaccttggcactgtacctgcgtggcgccgatgagccgcaa
ttgcgccagcgctcgatccaggccgccaacgtactgctcggcgccggcctgcaaccggtg
cgtgagggcgatgaagtggccgcctgcaacagctacctgcgctggctgccgatggtctac
aaccccgctcgtgataaacggaactggtacacccgcctgttgttcgctcagcatgtcgcc
aacctgttgccgctgtgggggcgtagcatcggtaccggcaacccagggatcaccttcttc
aaccgaggtggtgcgccgctgtcgttcgatcccctatcccgcttcgaccgctccatgaat
ggtcacctgctgttgttcggcccgaccggcgctggcaagtcggccaccttggtctcgatc
ctgatgcaagtcatggcggtgtatcggccgcggctgttcattgtcgaagctggcaactcc
ttcggcctgcagggcgactacttcgccaccctcggcctgaccgtcaataaggttcagctc
aagcccggcagcggcttgagcctggctcccttcgccgatgcccggcggctgatcgagcgc
cccgaccaggtcgccagtctgtcgaccgaagacctggatgaagacgcttcgggcagtgac
gagcaacgcgatgtgctgggcgaactggagattaccgctcgcctgatgatcaccgggggc
gaagtcaaggaagaggcccgcctcacccgggctgaccgcagcctgattcgcgagtgcatc
ctcgacgccgccaggcactgtgcggccagcgatcagcaggtcatgacgcgccatgttcgt
gatgcccttcgagtggtggccagcgacgcccatctgcccgacaagcgtcgcgagcgggcc
caagaaatggccgagtccatcgacctgttctgccagggcttcgagggtgcgctgttcgac
cgaccaggcaccccttggccggaaagcgatgtcacgatcgtcgacctcgccacctatgcc
cgcgagggctatgaagcgcagatgtcgatcagctacatcagcctgatgaacacggtgaac
aaccttgccgaacgcgatcaatacctcggtcgtccgatcatcatggtcactgacgaaggt
cacatcatcaccaagaacccgctgctggcgcccttcgtggtcaagggtaccaagatgtgg
cgcaagctcggcgcctggttctggctggcaacgcagaacctggccgacttccccgatgcg
gcgcagaccatgctcaacatgatcgaatggtggatctgcctgaacatgccgccggcggag
atcgaagagatcgcgcgcttcaagaagctcacgccagcacagaagaccctgctgttgtca
gcgagcaaggcctctggcaagtacaccgagggcgtggtcttgtcgaagcagctggagacg
ctgtttcgcgcagtcccgccgagtctgtacctcaccctggccatgaccgaacccgaagaa
aaggcccagcgctggcggttgatggaagcgcatcagctatccgagctggaggccgcactt
cggattgcggcggacatcgatcgcttgcgcggcatgtcctga

DBGET integrated database retrieval system