KEGG   Pseudomonas putida S16: PPS_2344Help
Entry
PPS_2344          CDS       T01570                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ppt  Pseudomonas putida S16
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438
Motif
Other DBs
NCBI-ProteinID: AEJ12905
UniProt: F8G4T0
Position
complement(2639388..2640194)
Genome map
AA seq 268 aa AA seqDB search
MMGVLILILVSVAGWCSAAGAVEVKYWDRLPLAVPLTVGQERILMLDEDVRVGLPGAITN
KLRVQSVGGTVYLRASEAIPPTRLQLQSVKSGDIILVDIEALQGSETLEPVKIVAQAQAP
DVETAKDAAPAATPVPVVLTRFAAQNLYAPLRTVAPLPGVRLVPLGESSGFSTLLPTEHV
SIKGLAAWRLGNYWVTAVKIVNRGSAKVTLDPRHLQATLYAATFQHEYLGHAGTPEDTTV
AYLVTRGGDLRHALLLPPPAPEAADHES
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtgtcttgatcctgattctggtgtcggtggccgggtggtgttcagccgcaggc
gccgtcgaagtcaaatactgggaccgcttgccgctggcagtgccgttgacggtgggtcag
gaacgtatcctgatgctggatgaggatgtccgcgtcggattgcccggtgcgattaccaat
aagctgcgtgtgcaatcggttggcgggacggtgtacctgcgtgcgtcggaagccatcccc
ccgacccgactgcagctgcagtcggtaaagtcaggcgacatcatcctggtcgacattgaa
gcgctccagggcagcgagacgctggagccggtcaagatcgtggctcaggcccaggcacca
gacgtggaaaccgcgaaggatgcagcaccggcagcgacgccggtaccggtggtgctgacc
cgcttcgcggcccagaacctgtatgcgccgctgcgcaccgtggcgcccttgcccggggtg
cgtctggtcccgctgggcgagtcttctggattcagcacgctcctgccgaccgagcacgtc
tccatcaagggacttgccgcctggcggctgggtaattattgggtgacggcggtgaagatc
gtcaaccgtgggtcggccaaggtcacactggacccgcgtcacctgcaggccacgctgtac
gccgctaccttccagcacgagtacctggggcacgccggcacacctgaagacaccaccgtg
gcgtacctcgtcacccgcggcggcgacctgaggcacgcgctgctgttgccaccgccagcg
ccggaggctgccgatcatgaaagctaa

DBGET integrated database retrieval system