KEGG   Pseudomonas putida S16: PPS_2345
Entry
PPS_2345          CDS       T01570                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ppt  Pseudomonas putida S16
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: AEJ12906
UniProt: F8G4T1
Position
complement(2640194..2640874)
AA seq 226 aa
MDGSAHAPACEDHSMSRFRNKVDAQQAHIFSLRLAVATLALLCSGIWYGWQSAPSELTIH
VPPDLRSGSTRKWWDVPPENIYAFALYIFGQLNRWPSDGEVDYHRAIFALQPYLTPACKA
FFDGDFEYRKAAGELRGRVRGVYEVLGRGYSDDPDLRVKQLDKHSWLVKLDLNADEYYAA
EPVKRVVVRYPLRVVRFDVDPERNKWGLALDCYEGTPQKLTLPGGA
NT seq 681 nt   +upstreamnt  +downstreamnt
gtggacggttcggcgcacgcgccggcctgcgaggaccactccatgagccgcttccgcaac
aaggtggatgcgcagcaggcgcacattttcagcctgcgcctggccgtagcgaccctggca
ctgctgtgcagtggcatctggtatggctggcagtccgcaccatccgaactgaccatccac
gtgccgccggatctgcgctccggcagcacgcgaaaatggtgggatgtgccgcccgagaat
atctatgccttcgccctgtatatcttcggtcagctaaaccgttggcccagcgatggcgag
gtcgactaccaccgcgccatctttgcccttcagccctacctgacaccggcgtgcaaggcc
ttcttcgatggtgacttcgagtaccgcaaggcggccggcgaactgcgcggtcgcgtgcgc
ggcgtgtacgaagtgctgggccgcggctacagcgatgatcccgatctgcgggtgaagcag
ctggataagcacagctggctggtcaagctcgacctgaatgccgacgaatactacgccgcc
gaaccggtgaagcgcgtggtcgtgcgctatccgctgcgggtggtgcgcttcgacgtcgac
cccgaacgcaacaaatggggcctggccctggactgttacgaaggcacaccgcagaagctg
acgctgcctggaggtgcgtga

DBGET integrated database retrieval system