KEGG   Pseudomonas putida S16: PPS_2841
Entry
PPS_2841          CDS       T01570                                 

Definition
(GenBank) type VI secretion ATPase
  KO
K11907  type VI secretion system protein VasG
Organism
ppt  Pseudomonas putida S16
Pathway
ppt02025  Biofilm formation - Pseudomonas aeruginosa
ppt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PPS_2841
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PPS_2841
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppt02044]
    PPS_2841
Secretion system [BR:ppt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PPS_2841
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small Clp_N TniB AAA_22 Sigma54_activat AAA_16 ATPase_2 NACHT AAA_7 AAA_25 AAA_14 Zeta_toxin AAA_24 Hpr_kinase_C
Other DBs
NCBI-ProteinID: AEJ13392
UniProt: F8FXM8
Position
3158956..3161541
AA seq 861 aa
MNLKSLFAKLNETSRTATESAAALCLSEHHYDVEVEHLLLQLLDNSDSDLAPILRHYEVV
AERLQAQLVTALGTFKKGNTRTPALSPHITRMIEQAWLLASIEYGVGQVRSAHLLQALLD
DAELRRVVIASAPELEKINADDLRLNLAALVEGSAESRQASPAAPVNSATKAGGKTPALD
QYTVNLTQSAREGRIDPVLGREFEVRQMVDILTRRRQNNPILTGEAGVGKTAVVEGLALR
IAQGDVPAVLKDVALHTLDLGLLQAGAGVKGEFENRLKAVIEEVKRSLHPIILFIDEAHT
LIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAALARRFQVVKVEEPD
EDKAIHMLRGLLGKMREHHKVAVMDEALVQAVRLSNRYITGRQLPDKAVSVLDTACARIA
LAQSSQPGALEDCRRQIDNLQAEIAVLGHEAGKGHDHTRRLGELQAALQAEQQREQQLNT
QWQQELELVEQLKALDAASEADAKQLNALRAELARVQGDQPLVHALVDSGAIAQVISGWT
GIPLGKMLRDEIDTVQRLPALLGERVLGQDHALHEIGKRIKISRARMEDPNKPIGVFLLL
GPSGVGKTETALALADTLYGGERNLITINMSEYQEAHTVSSLKGSPPGYVGYGEGGVLTE
AVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGVLDDGEGREINFRNTVIILTSNTGTER
IMQTCLNATELPTPAAIVEDLREQLNHVFKPAFLGRLSIVPFYPVQDQILERIVALKLER
IAKRFARNHQAELSYDQALVKAIAARCTEVDSGARNIDNILSQTLMPELAQRVLERMAQD
TPIQRLAIELGSDGDFAYRVA
NT seq 2586 nt   +upstreamnt  +downstreamnt
gtgaacctgaagtctctgttcgccaagctcaacgaaaccagccgcacggccacggaaagc
gcggcggccctgtgcctgtcggagcaccattacgacgtggaggtggagcacctgttgctg
cagttgctcgacaacagcgacagcgacctggcgccgatcctgcgccactacgaagtagtc
gccgagcgcctgcaggcgcagctggtcacggccctgggcaccttcaagaaaggtaatacc
cgcaccccggcgctgtcgccgcacatcacccgcatgatcgagcaggcctggctgctggcg
tcgatcgaatacggcgtcggccaggtgcgcagcgctcacctgctgcaggccctgctcgat
gatgccgaactgcgtcgcgtggtgatcgcctcggcgccggagctggagaaaatcaacgcc
gatgacctgcgcctgaaccttgccgcgcttgtagaaggcagcgccgagtcccggcaggcc
agccctgcggcgccagtgaacagtgcgaccaaggccggcggcaagaccccggcgttggac
cagtacacggtcaacctcacccagagcgcccgcgaaggccgcatcgacccggtgctgggc
cgcgagttcgaagtaaggcagatggtcgacatcctcacccgtcgccgccagaacaacccg
atcctcaccggcgaagccggggtcggcaaaaccgccgtggtcgaaggcctggccctgcgc
atcgcccaaggtgacgtgccggcggtgctcaaggatgtggccctgcacaccctcgacctg
ggcctgctgcaggccggcgccggcgtcaagggcgagttcgagaaccgcctcaaggcagtg
atcgaagaggtcaaacgcagcctgcacccgatcatcctgttcatcgacgaagcccacacc
ctgatcggttccggtggccaggccgggcagaacgatgccgccaacctgctcaagccggcc
cttgcccgtggcgagctgcgcaccatcgccgccactacctgggccgaatacaagaagtac
ttcgagaaggacgccgccctcgcccgccgcttccaggtggtcaaggtggaggaacccgac
gaagacaaggccatccacatgctgcgcggcctgctcggcaagatgcgcgaacaccacaag
gtagcggtgatggacgaagcgctggtgcaggccgtgcgcctgtccaaccgctacatcacc
ggccgccagctgcccgacaaggcggtcagcgtgctcgacaccgcctgcgcacgcattgcc
ctggcgcaatcgtcgcaacctggcgccctggaggactgccgccgccagatcgacaacctg
caggccgaaatcgccgtgctcggccacgaagccggcaaaggccacgaccacactcgccgc
ctgggcgagctgcaggctgccctgcaggccgagcagcagcgggagcagcagctgaacacg
cagtggcaacaggagctggaactggtcgaacagctcaaggcgctggacgccgccagcgag
gccgatgccaagcagctcaacgccctgcgtgccgaactggcccgcgtgcaaggcgaccag
cccctggtccatgccctggtcgacagcggcgccatcgcccaggtcatcagcggctggacc
ggtatcccgctgggcaagatgctgcgtgacgagatcgacaccgtgcagcgcctgccggcc
ctgcttggtgagcgcgtgctgggccaggaccacgccctgcacgagatcggcaagcgcatc
aagatttcccgcgcacgcatggaagacccgaacaaaccgatcggtgtgttcctgctgctc
ggccccagcggcgtcggcaagaccgaaaccgcgctggccctggccgataccctgtacggc
ggtgaacgcaacctcatcaccatcaacatgtccgagtaccaggaagcccacaccgtttcg
agcctcaagggctcgcctcccggctatgtcggctatggcgaaggcggcgtgctgaccgag
gcggtgcgccgcaagccgtacagcgtggtgttgctcgacgaggtggaaaaagcccacccc
gacgtgctcgaactgttcttccaggtattcgacaagggcgtgctggacgatggcgaaggc
cgcgagatcaatttccgcaacacggtgatcatcctcacctccaataccggtaccgagcgc
atcatgcagacctgcctgaacgccaccgagctaccgacgcccgcagcgatcgtcgaagac
ctgcgtgagcagctcaaccatgtgttcaagccggccttcctcggccgcctgagcatcgtg
ccgttctacccggtgcaggaccagatcctcgagcgcatcgtcgccctcaagctcgaacgc
atcgccaagcgcttcgcccgcaaccaccaggccgagctcagctacgaccaggcgttggtc
aaggccatcgccgcgcgctgcaccgaggtcgacagcggtgcgcgcaacatcgacaacatc
ctgtcccagaccctgatgcccgagctcgcccagcgcgtgctcgagcgcatggcccaggac
acgccgatccagcgtcttgcgatcgagctgggcagcgatggcgatttcgcctatcgcgtg
gcctga

DBGET integrated database retrieval system