KEGG   Pseudomonas putida S16: PPS_2845
Entry
PPS_2845          CDS       T01570                                 

Definition
(GenBank) ImcF domain-containing protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ppt  Pseudomonas putida S16
Pathway
ppt02025  Biofilm formation - Pseudomonas aeruginosa
ppt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PPS_2845
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PPS_2845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppt02044]
    PPS_2845
Secretion system [BR:ppt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PPS_2845
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C MMR_HSR1 AAA_16 CAP59_mtransfer
Other DBs
NCBI-ProteinID: AEJ13396
UniProt: F8FXN2
Position
3164372..3168175
AA seq 1267 aa
MKTLLRLLKNFWFLLLLLWLASLLTCWLVAPLLPWLQQHLPEALAIISACFLLVIVLRQY
QRIRAEHNLENLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSD
LPWYLVVGMSAAGKTSLLTHSGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRD
DQSASEFSAFLRMLRKQRGKAAINGLVMVVSLPELLAANSDERNALAAQLVARVEEYAEC
LDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTFGLSEIRNNGLHAVLQTRLGN
LQNHIRQHVDAQVIALGAEADSTLLNFPQYFAALSGVLEQFLEHFTRGHRGGAPLLLRGL
YFTSALQTGQQLGQVYEDVIADEFALQAAYDEHAENVGKAAGNRSYFITDTFRQVIFPDR
DLTLYQSRLGRQAAFSPLLLGLAAATGLLFIGWQALSFTNNRQWLDSLRGQLAQIEQAED
REQQLAAGKGLEVLREQMARVENHRLQGVPLQLGGGLYHGEAIHQVTRTAYLAQLRSQAL
EPIARSLQVQMRAFNTFANGINQELEFTPAPTPKKRNGKPLAPAIAAKAQAALGNSRAGA
YAAKVNLATASDAAELSATTGGLSLSEEMLGRLDEQQVASIIDAYNTLKLYLLLTEPQGH
PDPAFVAANLPQAWTNAATEGTPADAAVIAENAPLYVQLLEQGQAPSLPRNEQLINETRQ
NLKSFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRALLYGSAGVPAIYTRQGWD
TFVKPELIKLVSGNLRNESDWVLDGEGGDAIVQKANFVREFMTRYKRDYTQAWYKMVSSV
GVRHFADLASATQQLGLLSDVQNSPVKNLLAAVNDNTQWDLPAKHAIPALGSTREDGFWS
KVSGLFDDKDALPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALR
KLKVRMNNIQRSQDVGKSSKQLISETLEGQPSEVTTVRNYVESSVDTSQDGLSRSLQGLF
SLPIQYAWATLRDPAGQQIAKAWAQQIAKPWEQVMAHRYPIAGSSRNEASVKDLQRFVDP
DSGLLPAFKRNEIGNLAGGEGLGVGDGKAPALVNPGMLNSIDKASSVGQVIASLSDRDNG
FEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSNAPGARLDVVTLSGARVTV
FDFPGRWGLLRMNESARVEDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGDVKALSA
LNDRGAQ
NT seq 3804 nt   +upstreamnt  +downstreamnt
atgaaaacattattgcgccttttgaagaatttctggtttctcctgctgctgctgtggctg
gcgagcctgttgacctgctggttggtcgccccgttgctgccatggctgcaacagcacctg
cccgaagcactggcaatcatcagcgcctgcttcctgctggtgatcgtgctgcgccaatac
cagcgcattcgcgccgagcacaacctggagaacctgctgcagatcgaggttgatcgctcg
tggaatgccactggcgagttccgtgaccagcaggtgctgcgcgaacgcctcaagcatgcc
attgccatgttgcgcaccgaccgctccgctggaggcggtggcaaggcggcactgtccgat
ttgccctggtacctggtggttggcatgtcggcagccggcaagacctcgctgctgacccat
tccggcctgtcggccagcattgccacggccaacgacagcgaaagcggcacccagcactgc
gactggtacttcagccccgacgcggtaatgatcgacaccgccggccgctatttgcgtgat
gaccagtcggccagcgagttctcggccttcctgcgcatgctgcgcaagcagcgcggcaag
gcagcgatcaatggcctggtaatggtggtcagcctgcccgagctgctggcggccaacagc
gacgaacgcaatgccctggcggcccagctggtggcgcgggtggaagagtatgccgagtgc
ctcgacgccaacccgccggtctacctgatgctgagcaagaccgaccagttgccgggcttc
agccaggcgttcgacggcctcgatctgcatgaacgccagcaaccgctgggcatgaccttc
ggcctgtcggaaatccgcaacaacggcctgcacgccgtgctgcagacgcgcctgggcaac
ctgcagaaccacattcgccagcatgtcgacgcgcaggtgatcgccctcggtgccgaagcc
gacagcaccctgttgaacttcccgcaatacttcgccgcactcagcggtgtcctcgagcag
ttcctggagcacttcacccgcggccatcgcggcggtgccccgctgctgctgcgcggcttg
tacttcaccagtgccctgcagaccgggcagcagctgggccaggtatacgaagacgtcatc
gccgacgaattcgccctgcaagccgcctacgatgagcacgccgagaacgtcggcaaggcc
gcgggcaaccgcagctacttcatcaccgacaccttccgccaggtgatattccccgatcgc
gacctgaccctgtaccagtcgcgcctgggccgccaggctgcgttcagcccgctgctgctg
ggcctggccgccgccaccgggttgctgttcatcggttggcaggcactgtcgttcaccaat
aaccgccaatggctggacagcctgcgcgggcagctggcgcagatcgagcaggcagaagac
cgcgagcagcagctggccgctggcaagggcctggaagtgctgcgcgaacagatggcccgc
gtcgaaaaccatcgcctgcagggtgtaccactgcagttggggggtggcctgtaccatggc
gaagccatccaccaggtgactcgcaccgcctacctggcgcaactgcgcagccaggcgctg
gagccgatcgcacgcagcctgcaagtgcagatgcgggccttcaacaccttcgccaacggt
atcaaccaggagctggaattcaccccggccccgacaccgaaaaaacgcaatggcaagccg
ctggccccggccattgcagccaaggcccaggctgcgctgggcaacagccgcgccggtgcc
tatgccgccaaggtcaacctggccaccgccagcgatgccgccgagctgtctgccaccacc
ggtggcctgtcactgtccgaagaaatgctcgggcgcctcgacgaacagcaggtggcctcg
atcatcgatgcctacaacaccctcaagctgtacctgttgctgaccgagccccaaggccat
ccggacccggccttcgtcgctgccaacctgccccaggcctggaccaacgccgccaccgaa
ggcactccggccgacgcagccgtgatcgcagaaaatgccccgctgtacgtacagttgctg
gaacaaggccaggcgccgtcgttgccgcgtaacgaacagctgatcaacgaaacccggcaa
aacctcaagtcgttcatgatctccagctcgctggtcgatcgcgagtacctgcgcctgcaa
ctcgagtcgagccgccagttcccggccctgagcctgaacgacctggtgccgcaaccgggc
cgcgcgttgctgtatggctctgctggcgtaccggcaatctatacccgccagggctgggat
accttcgtcaagccggaactgatcaagctggtgtcgggcaacctgcgcaacgagtcggac
tgggtgctggacggtgaaggtggcgatgccatcgtgcaaaaggccaacttcgtgcgcgag
ttcatgacccgctacaaacgcgactacacccaggcctggtacaagatggtcagcagcgtg
ggggtacgccacttcgccgacctggcctcggccacccagcagctggggctgctcagcgat
gtgcagaactcgccggtaaagaacctgctggctgcggtcaatgacaacacccagtgggac
ctgccggccaagcacgctatcccggccctcggtagtacccgcgaagacggcttctggagc
aaggtctccggcctgttcgacgacaaggacgccctgcccgccaacgtcgccccggccctg
ccggcggtggacgacggcagcctggccaagcgcttcgaaccggtggcgcgagtatttgcc
gaaaacaacgccgaaggcgccgacagcaccatcatggaccgctacctggccgccttgcgc
aagctcaaggtgcgcatgaacaacatccagcgttcgcaggatgtgggcaagagcagcaag
cagctgatcagcgagaccctggaaggccagccgagcgaagtcaccaccgtacgcaactat
gtggaaagcagcgtcgacaccagccaggacggcctgtcgcgctcgctgcaggggctgttc
agcctgcctatccagtatgcctgggcgaccctgcgcgacccggccggccagcagatcgcc
aaggcctgggcgcagcagatcgccaagccttgggaacaggtcatggcgcaccgctacccg
attgccggcagcagccgcaacgaggcgtcggtaaaggacctgcagcgcttcgtcgacccc
gacagcggcctgctgccggccttcaagcgcaacgaaatcggcaacctggccgggggtgaa
ggcctgggtgtgggcgacggcaaggcaccggcgctggtcaacccaggcatgctcaacagc
atcgacaaggccagctccgtgggccaggtgatcgccagcctgtcggaccgtgacaacggc
ttcgaaatcatgctggaaccttctgccaacttcaccgacatcgtgttcaccctcgatggc
caggaacagcactaccgcaacggccgcagtagctggaaccgcttcgcctggccgggcacc
agcaacgctccgggtgcccgcctggatgtggtcaccctcagtggcgcgcgggtcaccgtg
ttcgacttccccgggcgctggggcctgctgcgcatgaacgaaagcgcccgggtcgaggac
ctggacggcattcagcaacgcttcagctggaacaccgccagcggccgcgtgagccttgta
gtgcgtaacttcggtggggtgaaactgaccgacctgggtgatgtcaaggcgctgagcgcc
ctcaacgacaggggcgcccaatga

DBGET integrated database retrieval system