KEGG   Pseudomonas putida S16: PPS_2847
Entry
PPS_2847          CDS       T01570                                 

Definition
(GenBank) OmpA/MotB domain-containing protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ppt  Pseudomonas putida S16
Pathway
ppt02025  Biofilm formation - Pseudomonas aeruginosa
ppt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PPS_2847
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PPS_2847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppt02044]
    PPS_2847
Secretion system [BR:ppt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PPS_2847
SSDB
Motif
Pfam: IcmF-related_N IcmF-related OmpA MMR_HSR1 DUF1232
Other DBs
NCBI-ProteinID: AEJ13398
UniProt: F8FXN4
Position
3169077..3171572
AA seq 831 aa
MNKIKYYCLRYQPYLLGVAFFLAIFLVWAIGCALGFASLHSLLAGIGVFLLLSAGYVLLL
YRGAGQHHNLEGLLRDDADQAVLNATPADREEVSLLRERLLQSIERLRSNTPRGTSAKDA
LYALPWYLVIGQPAAGKSTMILQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDT
AGRYMNSPEEAGKWRGFLQLLRQHRQRRPLNGLIVSVSIADILHGSAEDQDRVAKRLRER
IQESCALLEVRLPIYLVFTKCDLIPGFTPFYRQLDDAARGEVMGKTFSHKGYEQADWGQR
FGKAMDELTGYWQQVANQQLVQQDIQVTRQNNAAYRFPLELAALKPRLQQFVDSLLRANP
YQNAEMLRGFYFTAALQADEALWGSHGQHVAERFALEHAEGTATAVSQPAPLFINSLFRK
VIIPDQHLVALYTSNTRERRRKAGWVAATGLAALVLCSLWGWSYLNNRAILANIAGELAQ
AKADDQAARGQYAAWHSLDRLRFWAEHYYRQHREQGVPLGMRLGLYQGHEVEPLLRSRYF
ATLQNVMLKPTADNLTRTLYLLTTIKVYQRNTRELQPVSGVDSVEAEALPHDNRAQSIAD
FGKAALDTYVMLSPARRENADPAFLKAHLPDYWYPAIARHTGKSMAAAASEAGGNQNYLY
ASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQSLRSIETITLESDTLFAFGR
ADFQSLKSEGQRQLSAIASKLLNTPDIGKIIISGHADQLGDSQGNLQVSKQRAQTIRTYL
VGKGVPAELVVAQGEGSRKPLVNCDLQQPRAQLIKCLEPNRRVEIEVRGLN
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgaacaagatcaagtactactgcctgcgctaccaaccctacctgctgggagtggcgttc
ttcctggcgatcttcctggtctgggccatcggctgcgccctgggcttcgcctcgctgcat
agcctgctggccggtatcggcgtgtttctgctgctgtcggcaggctatgtactgctgctt
tatcgcggcgccggccagcaccacaacctcgaagggttactgcgcgacgatgccgaccag
gcggtactcaacgccacccccgccgaccgcgaagaagtaagcctgctgcgcgaacgcctg
ctgcagagcatcgagcgcctgcgcagtaacacacctcgcggcacctcggccaaggacgcg
ctgtacgccctgccctggtacctggtgatcggtcagccggctgccggcaagagcacgatg
atcctgcagtcgggcctgaacttcccctatgccgaacgcgaaggcgcacgggttgcgggg
cttggcggcacgcgcaactgcgactggttcttcagctccgaagccgtgctgctggatacc
gccgggcgctacatgaacagccccgaagaagccggcaagtggcgcggcttcctgcagctg
ttgcgccagcatcgccaacgccgccctctcaacggcttgatcgtcagcgtcagcatcgcc
gacatcctgcatggctcggccgaggaccaggaccgcgtggccaagcgcctgcgtgaacgg
atccaggaaagctgcgcgctgctggaagtgcgcctgccgatctacctggtgttcaccaag
tgcgacctgattcccggcttcaccccgttctatcgccagcttgacgacgccgcgcgtggc
gaggtgatgggcaagaccttctcgcacaagggttacgaacaggccgactggggccagcgt
ttcggcaaggcgatggacgagctgaccggttactggcagcaggtggcgaaccagcaactg
gtgcagcaagatattcaggtaacccggcagaacaatgcggcctatcgcttcccgctggag
ctggccgcactcaagccgcgcctgcaacaattcgtcgacagcctgctgcgcgccaacccg
taccagaacgccgaaatgctgcgcggtttctatttcactgccgcactgcaggccgatgaa
gccctgtggggcagccacggccagcatgtggccgaacgcttcgccctcgaacatgccgaa
ggcaccgccactgccgtcagccagccggcgccgctgttcatcaacagcctgttccgcaag
gtgatcatccccgaccagcacctggtggcgctgtacaccagcaacacgcgggagcgccgg
cgcaaggcgggctgggttgccgccaccggcctggcagccctggtgctgtgcagcctgtgg
ggctggtcgtacctgaacaaccgcgccatcctggccaacatcgccggcgaactggcccag
gccaaggccgacgaccaggctgcccgcggccagtacgccgcctggcatagccttgatcgc
ttgcgcttctgggccgagcactactatcggcagcaccgcgaacagggcgtgccgctgggc
atgcgcctgggcctgtaccagggccatgaggtcgagccgctgctgcgcagccgttacttc
gccacgctgcagaacgtgatgctcaagcccacggcagacaacctgacccgcaccctgtac
ctgctgaccacgatcaaggtgtaccagcgcaacacccgcgaactgcagcctgtgagcggc
gtggacagcgtcgaggccgaggcgctgccacatgacaaccgcgcgcagtcgatcgccgac
ttcggcaaggcggcgctggatacctacgtgatgctctcgccggcccgacgcgaaaacgcc
gacccggcgtttctcaaggcgcacctgcccgactactggtacccggccatcgctcgccat
accggcaagagcatggccgcggccgccagcgaggctggcggcaaccagaactatctgtac
gccagccgccagatcaccttctacagcgaccagattcgtgagccggatgtgccgcgtatc
ctcgacaacgccttcctgatgtccagttcgcgcaattacatcgacagcctgcgcgcccag
tcgctgcgttcgatcgagaccatcacgctggagtccgacaccctgttcgctttcggccgg
gccgacttccagagcctgaagagcgagggccagcgccagctgagcgcaatcgccagcaaa
ctgctgaacacgcccgacatcggcaagatcatcatttccggccacgccgaccagctcggc
gacagccaaggcaacctgcaggtttcgaaacagcgggcgcagaccattcgcacctacctg
gtcggcaagggcgtacctgccgaactggtggtcgcccagggcgaaggcagccgcaagccg
ctggtcaactgcgacctgcagcaaccgcgagcgcaactgatcaagtgcctggagcccaac
cgccgggtggaaatcgaagtacgcgggctcaactga

DBGET integrated database retrieval system