KEGG   Pseudomonas putida S16: PPS_2848
Entry
PPS_2848          CDS       T01570                                 

Definition
(GenBank) Hcp1 family type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ppt  Pseudomonas putida S16
Pathway
ppt02025  Biofilm formation - Pseudomonas aeruginosa
ppt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PPS_2848
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PPS_2848
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppt02044]
    PPS_2848
Secretion system [BR:ppt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PPS_2848
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AEJ13399
UniProt: F8FXN5
Position
3171716..3172234
AA seq 172 aa
MAFDAYIQIDGIPGEVLDAKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKI
RKAVDKASAKLFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVRFIAGGNQN
GEDKAVSDLPVEEISFNFARIKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcatttgacgcgtatatccaaatcgacggcatcccgggcgaagtactggatgcaaag
cacaaggactggatcgaagtgctgggctacgagtacggcgccacccaggccacctcggct
accgccagctcctcgggcggtgcgtcgtccgagcgtgttgccctgagcgacttcaagatc
cgcaaggcggtcgacaaggcttcggccaagctgttcgaacactgctgcaccggcaagcac
atcgccaagctgaagctgaacgtgaaccgcgccggtggtgacaaggtcacctacctgacc
atcgacatggaagaagtcgtggtgtcctcggtgcgcttcatcgccggtggcaaccagaac
ggtgaagacaaggctgtgagcgacctgccggtcgaagaaatcagcttcaacttcgcccgc
atcaagaccacctacacccagcagaaccgcaccgacggccaggctggcggcaacatcgtc
ggcggctgggaccgcaccgcgaacaaagtgtttgcctga

DBGET integrated database retrieval system