KEGG   Pseudomonas putida S16: PPS_3447Help
Entry
PPS_3447          CDS       T01570                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00030  Pentose phosphate pathway
ppt00480  Glutathione metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01200  Carbon metabolism
Module
ppt_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ppt_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ppt_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PPS_3447
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PPS_3447
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppt04147]
    PPS_3447
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     PPS_3447
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     PPS_3447
Exosome [BR:ppt04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PPS_3447
  Exosomal proteins of colorectal cancer cells
   PPS_3447
  Exosomal proteins of bladder cancer cells
   PPS_3447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AEJ13994
UniProt: F8G5U5
Position
complement(3875494..3876999)
Genome map
AA seq 501 aa AA seqDB search
MTKQSIPAAPPCTLFLFGANGDLVKRLLMPALYNLSRDGLLDRNLRIVGVDHNPATAEEF
AERLHAFMVERDKGGEGTAKCLDEKLWARLAKRLDYQTGDFLDPATYQALAKRIDTTRHG
NAIFYLATSPRFFPEVAQRLGQAGLLDESAGGFRRVVVEKPFGTDLASAEALNACLLKVM
GERQIYRIDHYLGKETVQNILVSRFSNGLFESFWNNHYIDHVQITAAETVGVETRGAFYD
STGALRDMVPNHLFQLLAMVAMEPPAAFAADAVRSEKAKVVGAIRPWSVKMALKNSVRGQ
YSAGKQGRKQLPGYRHEPNVAADSQTETYVALKVMIDNWRWAGVPFYLRTGKRMSVRDTE
IAICFKPAPYAQFRESELERPKPNYLKIQIQPNEGMWFDLQAKRPGPELVMENVELGFAY
KDFFKMTPATGYETLIYDCLTGDQTLFQRADNIENGWRAVQPFLDAWAQGGEVHEYPAGE
DGPEAGNELLARDKREWHWLG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacagagcattccggctgctccgccatgcaccctgttcctgttcggcgccaat
ggcgacctggtaaagcgcctgctgatgccggcgctttacaacctcagccgtgacggtctg
ctggaccgcaacctgcgcattgttggcgtcgaccacaacccggccactgctgaggaattc
gccgaacgcctgcacgcgttcatggtcgagcgtgacaaaggcggcgagggcacggccaag
tgcctggatgagaagctgtgggcacgcctggccaagcgcctggattaccagaccggcgat
ttcctcgatccggccacctaccaggccctcgccaagcgcatcgacacaacccgccacggc
aacgccatcttctatctggcgacctcgccgcgcttcttccccgaagtggcgcagcgcctg
gggcaggccgggctgctcgacgaatcggccggcggctttcgccgcgtcgtggtggaaaag
cccttcggcaccgacctggccagcgccgaggcgctcaacgcctgcctgctgaaggtgatg
ggcgagcggcagatctaccgcatcgaccattacctgggcaaagagacggtgcagaacatc
ctggtcagccggttctccaacggcttgttcgaatcgttctggaacaaccactacatcgac
catgtgcagatcaccgccgcggaaaccgtcggcgtcgagacccgtggtgcgttctacgac
agcaccggggcgttgcgcgacatggtgcccaaccacctgttccagttgctggcgatggtg
gccatggaacccccggccgcgttcgccgccgatgccgtgcgcagcgaaaaggccaaggtg
gtcggcgccatccgcccatggtcggtgaagatggccctgaaaaactccgtgcgtggccag
tacagtgccggcaagcaggggcgcaagcagttgcccggctaccgccacgagcccaacgtc
gcggcggatagccagaccgagacctatgtggcgctgaaggtgatgatcgacaactggcgc
tgggccggcgtgccgttctacctgcgtactggcaagcgcatgagcgtgcgtgataccgaa
atcgccatctgcttcaagcctgcgccctatgcgcagttccgcgagtcggagctggagcgg
cccaagcccaattacctgaagatccagatccagcccaacgaaggcatgtggttcgacctg
caggccaagcgccccgggccggagctggtaatggagaatgtcgagctgggctttgcctac
aaggacttcttcaagatgaccccggcgaccggctacgagacgctgatctacgactgcctg
accggtgaccagaccttgttccagcgggctgacaacatcgaaaacggctggcgcgcggtg
cagccgttcctcgatgcctgggcccagggcggcgaggtgcacgagtacccggccggtgaa
gacgggcccgaggccggcaatgaattgctggcgcgggacaagcgcgagtggcattggttg
gggtga

DBGET integrated database retrieval system