KEGG   Pseudomonas putida S16: PPS_3587Help
Entry
PPS_3587          CDS       T01570                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00020  Citrate cycle (TCA cycle)
ppt00640  Propanoate metabolism
ppt00660  C5-Branched dibasic acid metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01130  Biosynthesis of antibiotics
ppt01200  Carbon metabolism
Module
ppt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPS_3587
   00640 Propanoate metabolism
    PPS_3587
   00660 C5-Branched dibasic acid metabolism
    PPS_3587
Enzymes [BR:ppt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PPS_3587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AEJ14130
UniProt: F8FSN1
Position
complement(4038425..4039591)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEQAAEACDKIGGNEWVVKAQVHAGGRGKAGGV
KLVRSKEDAKAFAAQWLGKNLVTYQTDANGQPVSKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHETPEKILKATIDPLVGAQPFQGRELAFQLGLEGKQVQQFAKI
FVGLAKLFKDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKTFHDPSQDDA
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgagtacggcctgccagtttcc
aagggtttcgctgtcgatacccctgagcaagctgcagaagcctgcgacaagatcggcggg
aacgagtgggtggtaaaagcccaggttcacgcgggtggtcgcggtaaggcgggcggcgtc
aagctggttcgcagcaaagaagacgccaaggcgttcgctgcacagtggttgggcaagaat
ctggttacctaccagaccgatgccaacggtcaacccgtctccaagattctggtcgaatcc
tgcactgacatcgccaaagagctgtatctgggcgctgtagtcgatcgttcgagccgccgt
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaagtcgctcacgaaacg
cctgagaagatcctcaaggccaccatcgacccgctggtcggcgctcagccgttccagggt
cgcgagctggcgttccagctgggcctggaaggcaagcaagttcaacagttcgccaagatc
ttcgttggtctggccaagctgttcaaggatcacgacctggccctgctggaagtgaacccg
ctggtgatcaaggccgacggcgacctgcactgcctcgatgccaagatcaacatcgacgcc
aacgccatgtaccgtcagcctaagctgaaaaccttccacgacccgtcgcaggacgacgcc
cgtgaagcccacgctgccaagttcgaactgaactacgttgccctcgaaggcaacatcggc
tgcatggtcaacggtgccggcctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaaaccggccaacttcctcgacgttggtggtggtgctaccaaagagcgcgttaccgaa
gcgttcaagatcattctgtccgacagcaatgtcgcggccgttctggtcaacatcttcggc
ggcatcgttcgctgcgacatgattgccgaaggcatcatcggtgcagtgaaagaagtcggc
gtgaaagttccggttgtcgttcgccttgaaggcaacaacgccgaactgggcgctaaagta
ctggcagaaagcggtttgaacatcattgcggcaaccagcctgaccgacgctgctcaacaa
gttgtcaaagctgcggagggcaagtaa

DBGET integrated database retrieval system