KEGG   Pseudomonas putida S16: PPS_4627Help
Entry
PPS_4627          CDS       T01570                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00860  Porphyrin and chlorophyll metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
Module
ppt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPS_4627
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppt01007]
    PPS_4627
Enzymes [BR:ppt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     PPS_4627
Amino acid related enzymes [BR:ppt01007]
 Aminotransferase (transaminase)
  Class III
   PPS_4627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEJ15158
UniProt: F8G6N8
Position
5239886..5241169
Genome map
AA seq 427 aa AA seqDB search
MSRSEALFAQAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVVDEDDKRYVDYVGSWG
PMILGHGHPEVLDSVRRQLEHGLSYGAPTAMETEMADLVCSLVPSMEMVRMVSSGTEATM
SAIRLARGYTGRDAIIKFEGCYHGHSDSLLVKAGSGLLTQGVPSSAGVPADFAKHTLTLP
FNDIAAVEKTLAEVGQTVACIIVEPVAGNMNCVPPAPGFLEGLREQCDKHGVVLIFDEVM
TGFRVSLGGAQGHYGIKPDLSTFGKIVGGGMPVGCFGGKREIMGCIAPLGPVYQAGTLSG
NPLAMAAGLTTLKLISRPGFHAELTDYTSRMLDGLQQRADAAGVPFVTTQAGAMFGLYFS
GADDIVTFEDVMASDAERFKRFFHLMLDGGVYLAPSAFEAGFTSIAHGDKELQITLDAAE
KAFAALK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttccgaagccctgttcgcccaagcccagaagcacatccccggtggcgtcaac
tcgccggtccgcgctttcaagagcgttggcggcacgccgctgttcttcaagcatgccgaa
ggcgcctacgtcgttgacgaggatgacaagcgctacgtcgactacgtcggctcctggggc
ccgatgatcctcggccacggccacccggaggtactggactcggtacgcaggcagctggag
cacggcctgtcctatggcgccccgaccgccatggaaaccgagatggccgacctggtctgc
tcgctggtgccatccatggagatggtgcgcatggtcagctcgggcaccgaagccaccatg
agcgccatccgcctggcccgtggctacaccggccgtgacgccatcatcaagttcgaaggc
tgctaccacggccactccgacagcctgctggtaaaagcaggctccggcctgctgacccag
ggtgtgccgagctcggcgggcgtgccggcggacttcgccaaacacaccctgaccctgccg
ttcaacgacatcgccgccgtcgagaagaccctggccgaagtcggccagaccgtagcctgc
atcatcgtcgagccggtagccggcaacatgaactgcgtaccgccggcgccaggcttcctc
gaaggcctgcgcgagcagtgcgacaagcacggcgtggtgttgatcttcgacgaagtgatg
accggtttccgcgtttcgctcggcggcgcccagggccactatggcatcaagccggacctg
tcgaccttcggcaagatcgtcggcggcggcatgccggtcggctgcttcggcggcaagcgt
gaaatcatgggctgcattgccccgctcggcccggtctaccaggccggtaccctgtcgggt
aacccgctggccatggccgccggcctgaccaccctgaagctgatcagccgcccgggcttc
cacgccgagctgaccgactacaccagccgcatgctcgacggcctgcaacagcgcgccgat
gccgctggcgtgccgttcgtcaccacccaggccggtgcaatgttcggcctgtacttcagc
ggcgccgacgacatcgtcaccttcgaagacgtgatggccagcgatgccgagcgcttcaag
cgcttcttccacctgatgctcgatggtggcgtgtacctggcgccgagcgcgttcgaggcc
ggttttacctccatcgcccatggggacaaggagctgcagatcaccctggatgcggctgaa
aaggcttttgcagccctgaagtaa

DBGET integrated database retrieval system