KEGG   Pseudomonas putida S16: PPS_4791Help
Entry
PPS_4791          CDS       T01570                                 

Definition
(GenBank) trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00250  Alanine, aspartate and glutamate metabolism
ppt00330  Arginine and proline metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PPS_4791
   00330 Arginine and proline metabolism
    PPS_4791
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppt03000]
    PPS_4791
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     PPS_4791
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     PPS_4791
Transcription factors [BR:ppt03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    PPS_4791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AEJ15320
UniProt: F8FU29
Position
5425075..5428935
Genome map
AA seq 1286 aa AA seqDB search
MIKQAIFNYLEKLEGGATLTELNGHASNLADDAGEVQPDHSHQCFLEFAESILPQSVLRS
AITAAYRRPEQEVVPMLLEQARLSAPLAEATNKMAAGIAEKLRNQKSAGGRAGIVQGLLQ
EFSLSSQEGVALMCLAEALLRIPDKGTRDALIRDKISTGNWQPHLGNSPSLFVNAATWGL
LLTGKLVSTHNESGLTSSLTRIIGKSGEPMIRKGVDMAMRLMGEQFVTGETIAEALANAS
RFESKGFRYSYDMLGEAALTEHDAQKYLASYEQAIHSIGKASHGRGIYEGPGISIKLSAL
HPRYSRAQYERVMEELYPRLLSLTLLAKQYDIGLNIDAEEADRLELSLDLLERLCFEPSL
AGWNGIGFVIQAYQKRCPYVIDYVIDLAKRSRHRLMIRLVKGAYWDSEIKRAQVEGLEGY
PVYTRKVYTDVSYVACARKLLAVPEAIYPQFATHNAHTLSAIYHIAGQNYYPGQYEFQCL
HGMGEPLYEQVVGKISEGKLNRPCRVYAPVGTHETLLAYLVRRLLENGANTSFVNRIADH
SISIQELVADPVASIERMGTQEGSIGLPHPRIPLPRELYGSERANSAGIDMANEHRLASL
SCAMLATAHNDWKATPLLACAASEGTAAPVLNPADHRDVVGHVQEATVADVDNAIQCALN
AAPIWQATPPAERAAILERTADLMEAEIQPLMGLLIREAGKTFANAIAEVREAVDFLRYY
AVQARNDFSNDAHRPLGPVVCISPWNFPLAIFTGQVAAALAAGNPVLAKPAEQTPLIAAQ
AVRLLLEAGIPEGVLQLLPGRGETVGAGLVGDERVKGVMFTGSTEVARLLQRNVAGRLDN
QGRPIPLIAETGGQNAMIVDSSALTEQVVIDVVSSAFDSAGQRCSALRVLCLQEDSADRV
IEMLKGAMAESRLGCPDRLAVDIGPVIDAEAKAGIEKHIQGMREKGRSVYQVAIADAAEL
KRGTFVMPTLIELESFDELKREIFGPVLHVVRYNRRNLDQLIEQINNSGYGLTLGVHTRI
DETIAKVVETANAGNMYVNRNIVGAVVGVQPFGGEGLSGTGPKAGGPLYLYRLLSTRPAD
AIGRHFQQQDGEGKPDRALHEQLIKPLHGLKAWAESNQLADLAALCSQFASQSQSGIARL
LPGPTGERNSYTILPREHVLCLADNEADLLAQFAAVLAVGSSAVWADGEPGKALRARLPR
ELQAKVKLVADWNKDEVAFDAVIHHGDSDQLRGVCQQVAKRAGAIVGVHGLSSGDHQIAL
ERLVIERAVSVNTAAAGGNASLMTIG
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaagcaagcgatcttcaactacctggagaagctcgagggtggtgccaccctgacc
gaactcaacggccatgccagcaacctggccgacgacgccggtgaggtccaacctgaccac
agccatcagtgcttccttgagttcgccgagagtatcctgccgcagtcggtattgcgctcg
gcgatcaccgccgcctaccgccgccccgaacaggaagtggtaccgatgctgctggagcag
gcgcgcctgagcgccccgctggccgaagcgaccaacaagatggccgccggcatcgccgaa
aaactgcgtaaccagaagagcgctggcggccgtgccggcatcgttcagggcctgctgcag
gaattctcgctgtcgtcccaggaaggcgtggcactgatgtgcctggccgaagccctgctg
cgcatccccgacaagggcacccgtgatgcgctgatccgcgacaagatcagcaccggcaac
tggcaaccgcacctgggcaacagcccgtcgctgttcgtcaacgccgccacctggggcctg
ctgctgaccggcaagctggtatctacccacaatgaatccggcctcacctcctcgctcacc
cgcatcatcggcaagagcggcgagccgatgattcgcaagggcgtcgacatggccatgcgc
ctgatgggcgagcagttcgtcaccggcgaaaccatcgccgaagccctggccaatgccagc
cgcttcgagtccaagggcttccgctattcctacgacatgctcggcgaagccgcactgacc
gagcacgacgcacagaagtacctggcgtcctacgagcaggccatccactcgatcggcaag
gcctctcatggccgtggcatctatgaaggcccgggcatctcgatcaagctgtcggcactg
cacccgcgctacagccgcgcccagtacgagcgcgtgatggaagagctgtacccgcgcctg
ctgtcgctgaccctgctggccaagcagtacgacatcggcctgaacatcgacgccgaagaa
gccgaccgcctggagctgtcgctcgacctgctcgagcgcctgtgcttcgagccttcgctg
gccggctggaacggtatcggcttcgttatccaggcctaccagaagcgctgcccgtatgtg
atcgactatgtcatcgacctggccaagcgcagccgccaccgcctgatgatccgcctggtg
aaaggcgcctactgggacagcgaaatcaagcgcgcccaggtcgaaggcctggaaggctac
ccggtctacacccgcaaggtgtacaccgacgtgtcctacgtcgcctgcgcccgcaagctg
ctggccgtgccagaagccatctacccgcagttcgccacccacaacgcccacaccctgtcg
gccatctaccacattgccggtcagaactactacccgggccagtacgagttccagtgcctg
cacggcatgggcgagccactgtacgagcaggtggtcggcaagatttccgaaggcaagctg
aaccgtccgtgccgcgtctatgcaccggtcggcacccacgaaacgctgctggcctacctg
gtgcgtcgcctgctggaaaacggcgccaacacctcgttcgtcaaccgcatcgccgaccac
tcgatctccatccaggaactggtcgccgacccggtcgccagcatcgagcgcatgggcacc
caggaaggcagcatcggcctgccgcacccacgcatcccgctgccgcgtgagctgtatggc
agcgagcgggccaactcggccggcatcgacatggccaacgaacaccgcctggcatcgctg
tcctgcgccatgctggccaccgcccacaacgactggaaagccacgccactgctggcctgc
gctgccagcgaaggcaccgccgcaccggtcctgaacccggcggaccaccgcgacgtggtc
ggccatgttcaggaagccacggtcgccgacgtcgacaacgccatccagtgcgcactgaat
gccgctccgatctggcaggccaccccgccggccgaacgcgccgccattctggagcgcacc
gccgacctgatggaggccgaaatccagccgctgatgggcctgctcatccgcgaagccggc
aagaccttcgccaacgccatcgccgaagtgcgtgaagccgtggacttcctgcgctactac
gcggtgcaggcacgcaacgacttcagcaacgacgcccaccgcccgctgggcccggtggtg
tgcatcagcccgtggaacttcccgctggcgatcttcaccggccaggtagctgcagcgctc
gccgccggcaaccccgtactggccaagccggccgagcaaaccccgctgatcgctgcccag
gccgtgcgcctgctgctggaagccggcattcctgaaggcgtgctgcagctgctgcctggc
cgcggtgaaaccgtcggtgccggcctggtgggtgacgagcgcgtcaagggcgtgatgttc
accggttccactgaagtggcccgcctgctgcagcgcaacgtcgccggccgcctggacaac
cagggccgcccgatcccgctgatcgccgaaaccggcggccagaacgcgatgatcgtcgac
tcctcggcactgaccgagcaggtggtgatcgatgtggtgtcctcggccttcgacagcgcc
ggccagcgttgctcggcactgcgcgtgctgtgcctgcaggaagactccgccgaccgcgtg
atcgaaatgctcaagggtgccatggccgaaagtcgcctgggctgcccggaccgcctggcc
gtggacattggcccggtgatcgacgccgaagccaaagccggcatcgagaagcacatccag
ggcatgcgcgagaaaggtcgctcggtctaccaggtggccattgccgatgctgccgagctc
aagcgcggcaccttcgtgatgccgaccctgatcgagctggaaagctttgacgagctcaag
cgtgaaatcttcggtccggtgctgcacgtggtgcgctacaaccgtcgcaacctggaccag
ctgatcgagcagatcaacaattccggctacggcctgaccctcggcgtgcacacccgcatc
gacgagaccatcgccaaggtggtggaaaccgccaacgccggcaacatgtacgtcaaccgc
aacatcgtcggtgcagtggtgggtgtgcagccgttcggtggtgaaggcctgtctggcacc
ggcccgaaagccggcggcccgctgtacctgtaccgcctgctgtcgacccgcccggccgac
gcgattggccgccacttccagcagcaggacggcgaaggcaagcctgaccgcgccctgcac
gaacagctgatcaagccgctgcacggcctgaaggcatgggccgagagcaaccagctggcc
gacctggccgcgctgtgcagccagttcgccagccagtcgcagagcggcatcgcccgcctg
ttgccaggcccgaccggcgagcgcaacagctacaccatcctgccgcgtgagcacgtgctg
tgcctggccgacaacgaagctgacctgctggcgcagtttgccgcagtgctggccgttggc
agctcggcggtatgggcggacggcgagccgggcaaggccctgcgtgcccgcctgccgcga
gagttgcaggccaaggtcaaattggtggcggactggaacaaggatgaagtggcgttcgat
gccgtgatccaccatggcgactcggatcaactgcgcggcgtatgccagcaggtggccaag
cgtgccggggcgatcgtgggtgtgcacgggctgtccagcggcgaccaccagattgcgctg
gagcgcctggtgatcgaacgggcggtgagtgtgaacactgctgctgccggtggtaatgcc
agcttgatgaccattggctga

DBGET integrated database retrieval system