KEGG   Pseudomonas putida S16: PPS_5195Help
Entry
PPS_5195          CDS       T01570                                 

Definition
(GenBank) pyruvate carboxylase subunit B
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00020  Citrate cycle (TCA cycle)
ppt00620  Pyruvate metabolism
ppt01100  Metabolic pathways
ppt01120  Microbial metabolism in diverse environments
ppt01200  Carbon metabolism
ppt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPS_5195
   00620 Pyruvate metabolism
    PPS_5195
Enzymes [BR:ppt01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     PPS_5195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 RnfC_N HlyD_D23 NQRA GCV_H
Motif
Other DBs
NCBI-ProteinID: AEJ15722
UniProt: F8G0W0
Position
complement(5889553..5891361)
Genome map
AA seq 602 aa AA seqDB search
MSKKIHVTDTILRDAHQSLLATRMRTEDMLPICDKLDKVGYWSLEVWGGATFDACVRFLK
EDPWERLRKLRAALPNTRLQMLLRGQNLLGYRHYSDDVVKAFVAKAAVNGIDVFRIFDAM
NDVRNLRVAIEAVKAAGKHAQGTIAYTTSPVHTIEAFVNQAKQMEAMGCDSIAIKDMAGL
LTPFATGELVKALKAEQSLPVFIHSHDTAGLAAMCQLKAVENGADHIDTAISSFAWGTSH
PGTESMVAALKGSEFDTGLDLELLQEIGLYFYAVRKKYHQFESEFTAVDTRVQVNQVPGG
MISNLANQLKEQGALNRMNEVLAEIPRVREDLGFPPLVTPTSQIVGTQAFFNVLAGERYK
TITNEVKLYLQGGYGKAPGVVNEQLRRQAIGSEEVIDVRPADLLKPEMAKLRADIGALAR
CEEDVLTFAMFPDIGRKFLEEREAGTLTPEVLLPIPEAGAVASHSGEGVPTEFVIDVHGE
TYRVDITGVGVKAEGKRHFYLSIDGMPEEVVFEPLNEFVGGGSSKRKQASAPGHVSTTMP
GNIVDVLVKEGDMVKTGQAVLITEAMKMETEVQAGIAGKVVAIHVAKGDRVTPGEILIEI
EG
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaaaattcacgtaaccgacacgatcctgcgcgacgcccaccagtccctgctg
gccacccgcatgcgtaccgaagacatgctgccgatctgcgacaagctcgacaaggtcggc
tactggtcgctggaagtctggggtggcgccaccttcgacgcctgcgtgcgcttcctcaag
gaagacccgtgggagcgcctgcgcaagctgcgcgccgcgctgcccaacacccgcctgcaa
atgctgctgcgcggccagaacctgctgggctaccgccactacagcgacgacgtggtcaag
gcgttcgtcgccaaggccgcagtcaacggtatcgacgtgttccgtatcttcgatgccatg
aacgacgtgcgtaacctgcgcgtggccattgaagcggtcaaggctgccggcaaacacgct
cagggtaccatcgcctacaccaccagcccggtgcacaccatcgaagccttcgtgaaccag
gccaagcagatggaagccatgggttgcgactcgatcgcgatcaaggacatggccggcctg
ctgaccccgttcgccaccggcgaactggtcaaggcgctgaaagccgagcagtcgctgccg
gtgttcatccactcccacgacactgccggcctggccgcaatgtgccagctgaaggctgtg
gaaaacggcgccgatcacatcgacaccgccatctccagcttcgcttggggcaccagccac
ccgggtaccgagtcgatggttgccgcgctcaaaggcagcgaattcgatactggcctggac
ttggaactgctgcaggaaatcggcctgtacttctatgccgtgcgcaagaagtaccaccag
ttcgaaagcgagttcaccgccgtggacacccgcgtgcaggtcaaccaggtaccgggcggc
atgatttccaacctggccaaccagctcaaggagcagggcgccctcaaccgcatgaatgaa
gtgctggctgagatcccgcgcgtgcgtgaagaccttggcttcccaccgctggtgaccccg
acctcgcagatcgtcggtacccaggcgttcttcaacgtgctggccggcgagcgctacaag
accatcaccaacgaggtgaagctgtacctgcaaggcggttacggcaaggctccgggcgtg
gtcaacgagcagctgcgccgtcaggcgatcggcagtgaagaagtgatcgacgtgcgcccg
gccgacctgctgaagccggaaatggccaagctgcgtgccgatatcggcgccctggcccgt
tgcgaagaagacgtgctgactttcgccatgttccctgacattggccgcaagttcctcgaa
gaacgcgaagccggcaccctgactcccgaagtcctgctgccaattcctgaagcgggcgca
gtggcgtcccatagcggtgaaggcgtaccgaccgagttcgtcatcgacgtgcacggcgaa
acctaccgtgtcgacatcaccggtgtgggcgtgaaggccgaaggcaagcgccacttctac
ctgtcgatcgacggcatgccggaagaagtggtgttcgagccgctcaacgaattcgtcggc
ggcggcagcagcaagcgcaagcaggccagtgccccgggccacgtcagcaccaccatgcca
ggcaacatcgtcgatgtgctggtcaaggaaggcgacatggtcaagaccggccaggccgtg
ctgatcaccgaagccatgaagatggagaccgaagtgcaggcgggtatcgctggcaaggtg
gtggccatccacgtggccaagggcgaccgtgtgactccgggcgagatcctgatcgagatc
gagggctga

DBGET integrated database retrieval system