KEGG   Pseudomonas putida KT2440: PP_0043
Entry
PP_0043           CDS       T00114                                 
Symbol
czcA-I
Name
(GenBank) cation efflux system protein
  KO
K15726  heavy metal efflux system protein
Organism
ppu  Pseudomonas putida KT2440
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppu02000]
    PP_0043 (czcA-I)
Transporters [BR:ppu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   PP_0043 (czcA-I)
SSDB
Motif
Pfam: ACR_tran
Other DBs
NCBI-ProteinID: AAN65677
UniProt: Q88RT6
Position
complement(46213..49374)
AA seq 1053 aa
MFERIIRFAIEQRIVVMIAVLIMAGIGIYSYQKLPIDAVPDITNVQVQINTAAPGYSPLE
TEQRITFPVETAMAGLPGLQQTRSLSRSGLSQVTVIFKDGTDIFFARQLINERLQVAKEQ
LPEGVEAVMGPVSTGLGEIFLWTVEAEDGAVKEDGTPYTPTDLRVIQDWIIKPQLRNVPG
VAEINTIGGYAKQFLVAPDPKRLATYKLTLNDLVAALESNNANVGAGYIERNGEQLLIRA
PGQVGNIEDIANIVITSVDGAPIRISSVADVSIGKELRTGAATENGREVVLGTVFMLIGE
NSRTVSQAVAAKLADINRTLPKGVVAVTVYDRTNLVEKAIATVKKNLVEGAILVIAILFL
FLGNIRAALITAMVIPLSMLFTFTGMFNNKVSANLMSLGALDFGIIVDGAVVIVENAIRR
LAHAQHKHGRMLTKTERFHEVFAAAREARRPLIFGQLIIMVVYLPIFALTGVEGKMFHPM
AFTVVMALLGAMVLSVTFVPAAIAMFVTGKVKEEEGVVMRTARLRYEPVLQWVLGHRNIA
FSAAVALVVLSGLLASRMGSEFIPSLSEGDFAMQAMRVPGTSLTQSVEMQQRLEKAVIAQ
VPEVERMFARSGTAEIASDPMPPNASDAYIMLKPQDQWPNPKKPRDELIAEVQKAAAGVP
GSNYELSQPIQLRFNELISGVRSDVAVKVFGDDMDVLNNTANKIAAALKAVPGSSEVKVE
QTSGLPVLTINIDREKAARYGLNIADVQNSIAIAVGGRQAGTLYEGDRRFDMVVRLPETV
RTDVAGMSSLLIPVPANAAQGANQIGFIPLSQVANLDLQLGPNQISRENGKRLVIVSANV
RGRDLGSFVEEATASLDKKVQIPAGYWTTWGGQFEQLQSAAKRLQIVVPVALLLVMTLLF
LMFNNLKDGMLVFTGIPFALTGGVVALWLRDIPLSISAGVGFIALSGVAVLNGLVMIAFI
RGLREEGRTLRQAVDEGALTRLRPVLMTALVASLGFIPMALATGTGAEVQRPLATVVIGG
ILSSTALTLLVLPALYHWAHRKDEDGDEAEVVS
NT seq 3162 nt   +upstreamnt  +downstreamnt
atgtttgaacgtatcatcagattcgccatcgagcagcgcatcgtagtaatgatcgccgtt
ctgatcatggcgggtatcggtatctacagctatcaaaagctgcccatcgatgcggtaccc
gatatcaccaacgtccaggtgcagatcaacactgcagcgcctggttactcgcccttggaa
accgaacaacggatcacgtttccagttgaaacggccatggccggtctcccgggccttcag
cagacccgttccctgtctcgctctggcctgtctcaggtcaccgtgatcttcaaggatggc
actgacatcttctttgcccgccagttgatcaacgagcggctgcaggttgcgaaggaacag
ctgccagaaggtgtagaggccgtcatgggtccggtatctaccggcctcggcgagatcttc
ctgtggactgttgaagccgaagatggcgcggtcaaagaggacggtacgccgtacaccccg
accgacctgcgcgtgatccaggactggatcatcaagcctcagctgcgtaacgtcccgggt
gtggccgagatcaataccatcggcggttatgccaagcagttcctggttgcgccggatcca
aagcgcctggctacctacaagctgacactcaatgacctggtcgcagcgttggaaagtaac
aacgccaacgtcggtgccggctacatcgagcgtaatggtgaacagttgctcatccgtgca
ccgggtcaggtaggcaatatcgaagacatcgccaacatcgtgatcaccagtgtggatggt
gcaccgattcgcatcagcagcgttgctgacgtcagcatcggtaaagagctccgtacaggt
gctgctactgagaacggccgcgaagtcgtgctcggtaccgtgttcatgctgattggtgaa
aacagccgcaccgtatctcaagctgtcgccgccaaattggcggacatcaaccgcaccctg
ccaaagggcgtggtggctgtgactgtttacgaccgtaccaacctggttgaaaaagccatc
gcgacggtgaagaagaacctggtggaaggcgcgatcctggttatcgccattctgttcctg
ttcctcggcaacatccgtgcggctctgatcaccgcgatggtgattccgctgtccatgctg
ttcaccttcacaggcatgttcaacaacaaggtcagtgccaacttaatgagtttgggggca
ctcgacttcggcatcatcgtcgacggtgccgtggttattgtagaaaacgcgatccgtcga
ctggctcatgcgcaacataagcatggccgcatgctcaccaaaaccgaacgcttccacgag
gtctttgccgcggcgcgagaagctcgccggccgctgatcttcggtcagctgatcatcatg
gtggtgtacctgccgatcttcgccctcaccggcgtcgaaggcaaaatgttccacccgatg
gccttcaccgttgtgatggcgctgctgggtgcaatggtcctgtccgttacctttgttcct
gcagctattgccatgttcgtcactggcaaggtgaaggaagaggaaggcgtggtcatgcgc
acagctcgactgcgctatgaaccggttctgcaatgggtgctgggacatcggaacatcgct
ttctcggccgcagtagccttggtcgtgctcagtggtttgctggcaagtcgtatgggtagc
gagttcatcccaagcctcagtgagggtgactttgcgatgcaggccatgcgtgtgcctgga
acgagcctcactcaatctgtcgagatgcagcagcgtctggagaaagcggtgattgcgcag
gtgcctgaagttgagcggatgttcgcacgctcgggtaccgcagaaattgcatctgacccg
atgccgccgaacgcctctgacgcctacatcatgctcaagcctcaggatcagtggcctaac
ccgaagaagcctcgtgatgagctgattgctgaagtgcagaaggccgcagcgggtgttcca
ggaagcaactacgagttgtcgcagccaatccaactgcgtttcaacgagctgatttcgggc
gtgcgtagtgacgtcgctgtgaaagtcttcggcgatgacatggacgtgctcaacaacacc
gccaacaagatcgcggcagcgctcaaagcggtcccgggctcatcggaagtgaaagttgag
cagacatccggcctgccggtgctgaccatcaacattgaccgcgaaaaagcagcacgctac
ggcctgaacatcgcggatgttcagaactcgatcgctatcgccgtgggtggccgtcaggcc
ggcacgctgtatgagggcgaccgtcggttcgacatggtagtacgcctaccagagaccgtt
cgcaccgacgtagcgggtatgtccagcttgctgatcccggtacctgccaatgcggcacag
ggtgccaatcagatcggcttcatcccgctgtcccaggtcgccaatctggacctgcaactg
ggcccgaaccaaatcagccgcgagaacggcaaacgtctggttatcgtcagcgccaacgtt
cgaggccgcgatctggggtccttcgttgaggaggcgaccgcatcgctggacaagaaggtg
caaatccctgcgggctactggacgacttgggggggccagttcgagcagctgcagtcggct
gccaaacgcctgcagatcgttgttccagtcgccttgctgctggtcatgaccttgttgttc
ctgatgttcaacaacctgaaggacggcatgctggtcttcaccggtattccattcgcactc
accggtggtgttgtggcgttgtggctgcgggacatcccactgtcgatctcggcaggtgtc
ggcttcattgcactgtccggcgttgcagtactgaacggcctggtgatgattgccttcatc
cgcgggctaagggaggagggacgaacgctcagacaggcagtcgatgaaggtgcattgacc
cgtctgcgacctgttctgatgacagccttggtagcgtccctgggcttcatcccgatggct
ttggccaccggcaccggtgccgaagttcagcggccattggcgacggtggtgattggcggg
atcctgtcctccaccgcactgaccttgctggtactgcctgccctgtatcactgggcacac
cgcaaggatgaagacggcgacgaggccgaagtggttagctaa

DBGET integrated database retrieval system