KEGG   Pseudomonas putida KT2440: PP_0214Help
Entry
PP_0214           CDS       T00114                                 

Gene name
gabT
Definition
(RefSeq) 5-aminovalerate aminotransferase DavT
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00250  Alanine, aspartate and glutamate metabolism
ppu00310  Lysine degradation
ppu00650  Butanoate metabolism
ppu01100  Metabolic pathways
ppu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PP_0214 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PP_0214 (gabT)
   00310 Lysine degradation
    PP_0214 (gabT)
Enzymes [BR:ppu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PP_0214 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     PP_0214 (gabT)
Amino acid related enzymes [BR:ppu01007]
 Aminotransferase (transaminase)
  Class III
   PP_0214 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 1043757
NCBI-ProteinID: NP_742382
UniProt: Q88RB9
Position
264875..266152
Genome map
AA seq 425 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGRELIDFAGGIAVLNTGHLH
PKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDFDKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALFPSELHGIS
VDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPAPKELMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVIEVFEEEKLLDRSKAVGERLTAGLREIQKKYPIIGDVRGLGSMIAVEV
FEKGTHTPNAAAVGQVVAKAREKGLILLSCGTYGNVLRILVPLTAEDALLDKGLAIIEEC
FAEIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaccaacgaatccttgatgcaacgtcgtgtagctgccgtcccacgtggcgtc
ggccagatccacccgatcttcgtcgacaccgcgaagaactcgaccgtgatcgacgttgaa
ggccgcgaactgatcgacttcgccggcggcatcgcagtactgaacaccggccacctgcac
ccgaaagtagttgcagccgtgcaagagcagctgaccaaggtcagccacacctgcttccag
gtgctggcttacgagccctatgtagagctgtgcgaaaagatcaacaagctggtcccaggc
gacttcgacaagaagaccctgctggtcaccaccggctccgaagccgttgaaaacgccgtc
aagatcgcccgtgctgccactggccgcgctggcgtcatcgccttcaccggcggttatcac
ggccgtaccatgatgaccctgggcctgaccggcaaggtcgtgccgtactccgctggcatg
ggcctgatgccaggcggcatcttccgcgccctgttcccgagcgaactgcacggtatcagc
gttgacgacgccatcgcctcggtcgagcgcatcttcaagaacgacgccgagccgcgcgac
atcgccgcaatcatcctcgagccagtacaaggcgaaggcggcttcctgccagcgccgaaa
gagctgatgaagcgcctgcgcgccctgtgcgaccagcacggcatcctgctgatcgccgac
gaagtacaaactggcgctggccgtaccggcaccttcttcgccatggaacagatgggcgtt
gcgcctgacctgaccaccttcgccaaatccatcgctggcggcttcccgctggccggtgtg
tgcggcaaggccgaatacatggacgccatcgcgcctggcggcctgggcggtacctacgcc
ggttcgccgatcgcttgcgccgcggccctggccgtgatcgaagtgttcgaagaagaaaaa
ctgctggaccgcagcaaggctgtgggtgagcgcctgaccgccggcctgcgcgaaatccag
aagaagtacccgatcatcggcgacgtccgtggtctgggctcgatgattgccgtcgaagtc
ttcgagaagggcactcacaccccgaacgctgctgctgttggccaggttgtcgccaaggct
cgtgaaaagggtctgatcctgctgtcttgcggcacctacggcaacgtcctgcgtatcctg
gttccgctgaccgccgaagacgcgctgctggacaaaggcctggccatcatcgaagagtgc
ttcgctgaaatcgcctga

DBGET integrated database retrieval system